Os01t0591000-02

Locus

Os01g0591000

Description

Aldehyde/histidinol dehydrogenase domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ALDH1A

CGSNL Gene Name

ALDEHYDE DEHYDROGENASE 1A

Oryzabase Gene Symbol Synonym(s)

ALDH1a, Aldh1a, OsALDH1a, OsALDH2C4, ALDH2C4

Oryzabase Gene Name Synonym(s)

aldehyde dehydrogenase 1a, aldehyde dehydrogenase 2C4

Transcript Evidence

AK105638 (DDBJ, Best hit)

AK121462 (DDBJ, Best hit)

Protein Evidence

A4UUE0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (GO:0016620)

Functional domain (InterPro)

Aldehyde dehydrogenase domain (IPR015590)

Aldehyde dehydrogenase, conserved site (IPR016160)

Aldehyde/histidinol dehydrogenase (IPR016161)

Aldehyde dehydrogenase, N-terminal (IPR016162)

Aldehyde dehydrogenase, C-terminal (IPR016163)

Full-length cDNA

001-200-E03 (Online Clone Ordering)

J023144F17 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0591000-02)

RiceXPro (AK105638)

Others

Oryzabase (20179)

KEGG (Os01t0591000-02 (EC:1.2.1.3))

Transcript

1729 bp

>Os01t0591000-02 Aldehyde/histidinol dehydrogenase domain containing protein.
ACATCTCCAAACTTCCAATTTCTCTCTCCACATCTCTCTGTGTTTCTTTTATTTCTCCTC
TGCTCGCGGCGATGGCGGCGGCGAACGGCGGCGACAGCAAGGGGTTCGAGGTGCCGAAGC
TGGAGATCAAGTTCACCAAGCTCTTCATCAATGGCCGCTTCGTCGACGCCGTCTCCGGCA
AGACATTCGAAACCCGTGACCCGCGCACCGGCGAGGTCATCGCCAAGATCGCCGAAGGAG
ACAAGGCCGACATCGACCTCGCCGTGAAGGCCGCCAGGGAGGCCTTCGACCATGGCCCCT
GGCCAAGAATGTCCGGCTTTGCGAGGGGAAGGATCCTGCACAAGTTCGCGGACCTGGTGG
AGCAGCACGTGGAGGAGCTGGCGGCGCTGGACACGGTGGACGCCGGCAAGCTGTTCGCGA
TGGGGAAGCTCGTCGACATCCCCGGCGGCGCGAACCTGCTCCGGTACTACGCCGGCGCGG
CGGACAAGGTGCACGGCGAGACGCTCAAGATGGCGCGGCCATGCCACGGGTACACGCTCA
AGGAGCCCGTCGGCGTCGTCGGCCACATCGTGCCGTGGAACTACCCCACCACCATGTTCT
TCTTCAAGGCCagcccggcgctcgccgccggctgcaccatggtcgtcaagcccgccgagc
agacccccctctccgcgcTCTTCTACGCCCACCTCGCCAAGCTTGCCGGCGTCCCCGACG
GCGTGCTCAACGTCGTCCCCGGCTTCGGCCCCACCGCCGGCGCCGCTATCTCCTCCCACA
TGGACATTGACAAGGTGAGCTTCACCGGCTCGACGGAGGTCGGCCGGCTGGTGATGGAGG
CGGCGGCGAAGAGCAACCTGAAGCCCGTCTCGCTCGAGCTGGGTGGCAAGTCTCCGGTCA
TCGTGTTCGACGACGCCGACCTCGACACGGCCGTGAACCTGGTCCACATGGCCTCCTACA
CCAACAAGGGTGAGATCTGCGTCGCCGGCTCGCGAATCTATGTCCAGGAGGGGATCTACG
ATGCGTTCGTGAAGAAGGCGACCGAGATGGCCAAGAAATCGGTGGTCGGAGATCCGTTCA
ACCCGCGAGTTCATCAAGGCCCTCAGATTGACAAGGAGCAATACGAGAAGATCCTCAAGT
ACATCGACATCGGTAAGCGCGAAGGCGCGACGTTGGTCACCGGAGGGAAGCCCTGCGGCG
AAAACGGGTACTACATCGAGCCCACCATCTTCACGGACGTCAAGGAAGAAATGTCGATCG
CGCAAGAGGAAATCTTCGGGCCGGTGATGGCCCTCATGAAATTCAAGACGGTTGAGGAGG
CGATCCAGAAGGCGAACAGCACCCGGTACGGCCTGGCTGCCGGCATAGTCACCAAGAACA
TCGACGTCGCGAACACGGTTTCGCGGTCGATCCGGGCAGGGGCAATCTGGATCAATTGCT
ACCTCGGCTTCGACCCCGACGTGCCGTTCGGGGGGTACAAGATGAGCGGCTTCGGCAAGG
ACATGGGCATGGACGCCCTTGAGAAGTACCTCCACACCAAGGCGGTGGTCACCCCTCTCT
ACAACACCCCTTGGCTATGATCTGATGATGAACAGCACAGAAAGATTAATTACAGTGGAA
AAAAATAACATTTCTATATATACAGCTGAAAGGTTGGGTTATATTTGTGGTTAGTTGATT
GCTTGTATCAAATATCAATTTGTCGGAATAAAGACAGTATATTTCAGTT

CDS

1509 bp

>Os01t0591000-02 Aldehyde/histidinol dehydrogenase domain containing protein.
ATGGCGGCGGCGAACGGCGGCGACAGCAAGGGGTTCGAGGTGCCGAAGCTGGAGATCAAG
TTCACCAAGCTCTTCATCAATGGCCGCTTCGTCGACGCCGTCTCCGGCAAGACATTCGAA
ACCCGTGACCCGCGCACCGGCGAGGTCATCGCCAAGATCGCCGAAGGAGACAAGGCCGAC
ATCGACCTCGCCGTGAAGGCCGCCAGGGAGGCCTTCGACCATGGCCCCTGGCCAAGAATG
TCCGGCTTTGCGAGGGGAAGGATCCTGCACAAGTTCGCGGACCTGGTGGAGCAGCACGTG
GAGGAGCTGGCGGCGCTGGACACGGTGGACGCCGGCAAGCTGTTCGCGATGGGGAAGCTC
GTCGACATCCCCGGCGGCGCGAACCTGCTCCGGTACTACGCCGGCGCGGCGGACAAGGTG
CACGGCGAGACGCTCAAGATGGCGCGGCCATGCCACGGGTACACGCTCAAGGAGCCCGTC
GGCGTCGTCGGCCACATCGTGCCGTGGAACTACCCCACCACCATGTTCTTCTTCAAGGCC
agcccggcgctcgccgccggctgcaccatggtcgtcaagcccgccgagcagacccccctc
tccgcgcTCTTCTACGCCCACCTCGCCAAGCTTGCCGGCGTCCCCGACGGCGTGCTCAAC
GTCGTCCCCGGCTTCGGCCCCACCGCCGGCGCCGCTATCTCCTCCCACATGGACATTGAC
AAGGTGAGCTTCACCGGCTCGACGGAGGTCGGCCGGCTGGTGATGGAGGCGGCGGCGAAG
AGCAACCTGAAGCCCGTCTCGCTCGAGCTGGGTGGCAAGTCTCCGGTCATCGTGTTCGAC
GACGCCGACCTCGACACGGCCGTGAACCTGGTCCACATGGCCTCCTACACCAACAAGGGT
GAGATCTGCGTCGCCGGCTCGCGAATCTATGTCCAGGAGGGGATCTACGATGCGTTCGTG
AAGAAGGCGACCGAGATGGCCAAGAAATCGGTGGTCGGAGATCCGTTCAACCCGCGAGTT
CATCAAGGCCCTCAGATTGACAAGGAGCAATACGAGAAGATCCTCAAGTACATCGACATC
GGTAAGCGCGAAGGCGCGACGTTGGTCACCGGAGGGAAGCCCTGCGGCGAAAACGGGTAC
TACATCGAGCCCACCATCTTCACGGACGTCAAGGAAGAAATGTCGATCGCGCAAGAGGAA
ATCTTCGGGCCGGTGATGGCCCTCATGAAATTCAAGACGGTTGAGGAGGCGATCCAGAAG
GCGAACAGCACCCGGTACGGCCTGGCTGCCGGCATAGTCACCAAGAACATCGACGTCGCG
AACACGGTTTCGCGGTCGATCCGGGCAGGGGCAATCTGGATCAATTGCTACCTCGGCTTC
GACCCCGACGTGCCGTTCGGGGGGTACAAGATGAGCGGCTTCGGCAAGGACATGGGCATG
GACGCCCTTGAGAAGTACCTCCACACCAAGGCGGTGGTCACCCCTCTCTACAACACCCCT
TGGCTATGA

Protein

503 aa

>Os01t0591000-02 Aldehyde/histidinol dehydrogenase domain containing protein.
MAAANGGDSKGFEVPKLEIKFTKLFINGRFVDAVSGKTFETRDPRTGEVIAKIAEGDKAD
IDLAVKAAREAFDHGPWPRMSGFARGRILHKFADLVEQHVEELAALDTVDAGKLFAMGKL
VDIPGGANLLRYYAGAADKVHGETLKMARPCHGYTLKEPVGVVGHIVPWNYPTTMFFFKA
SPALAAGCTMVVKPAEQTPLSALFYAHLAKLAGVPDGVLNVVPGFGPTAGAAISSHMDID
KVSFTGSTEVGRLVMEAAAKSNLKPVSLELGGKSPVIVFDDADLDTAVNLVHMASYTNKG
EICVAGSRIYVQEGIYDAFVKKATEMAKKSVVGDPFNPRVHQGPQIDKEQYEKILKYIDI
GKREGATLVTGGKPCGENGYYIEPTIFTDVKEEMSIAQEEIFGPVMALMKFKTVEEAIQK
ANSTRYGLAAGIVTKNIDVANTVSRSIRAGAIWINCYLGFDPDVPFGGYKMSGFGKDMGM
DALEKYLHTKAVVTPLYNTPWL*

5'UTR

chr01:23097337..23097407 (+ strand) : 71 bp

CDS

chr01:23097408..23097513 (+ strand) : 106 bp

chr01:23103831..23103973 (+ strand) : 143 bp

chr01:23104135..23104608 (+ strand) : 474 bp

chr01:23104839..23105012 (+ strand) : 174 bp

chr01:23105119..23105256 (+ strand) : 138 bp

chr01:23105378..23105513 (+ strand) : 136 bp

chr01:23105638..23105701 (+ strand) : 64 bp

chr01:23105799..23106072 (+ strand) : 274 bp

3'UTR

chr01:23106073..23106221 (+ strand) : 149 bp

FASTA

>Os01t0591000-02 class=Sequence position=chr01:23097337..23106221 (+ strand)
ACATCTCCAA ACTTCCAATT TCTCTCTCCA CATCTCTCTG TGTTTCTTTT ATTTCTCCTC TGCTCGCGGC GATGGCGGCG
GCGAACGGCG GCGACAGCAA GGGGTTCGAG GTGCCGAAGC TGGAGATCAA GTTCACCAAG CTCTTCATCA ATGGCCGCTT
CGTCGACGCC GTCTCCGGTA CGTCGCTGCG TGCTTCCTAA TTAATCCTCC CTCTTGCATC TTTCACCTTT TTTTTAATTA
TTATTCTTCT CCTGATGCTT TTTTTGACTC ACGAAAGTTA GCAACAAGAA GCATCTGTTA GTACTTCTGT TTCTTTATTG
TTTGCAACTT TCTTTTTTta ctatctccgt ttcgtattag aaattaacat aaacttcttt aagtttaaca atttttttaa
agaaatagca acatttagaa cacaaaacaa acgcaatatt aaaatatatt aaatattggt ttagatgaaa ctaatttagc
gttgtaaacg ttgctaatat ttttaataaa cctgaacaaa ctcaaaagtt tgattagaaa aaaaatcaaa acgaAAACAG
AGACGGATAT AGAGTATTGA TTAGTCACAA TACGTGCGAC ACCCTGCGCT TTTAACACCA AGTTAGATAA ATGTGATAGC
CGAGTAGTAT CTATAGCGTG TTAAGAAGTG CGGGACGTCA TAGTACGCAA GTGAGGGTGA TTTATCGTGT AAAAAAGATA
GAAGAAACCG AATGTGAGGA TGAGACAATG GTAGTATGGT ATCTAGATTT AAGCATTGCT TCGGAGAATT TGTTTACTGA
ATGAATGCAT GAGTTTCACC GAATTTTCGA ATAAATAGGT ATAATTCCTG TAAAGTTCAT TAAAAAAAAA CCTCTATTCC
AAAAGAGGCT TAAAATATTA CTACCAAATA TGCATATTTA AATGCATGTT GCATGGTCCA CCCTGTTCCA TGTGGAGGTA
AATCAAATGA GGCCTAATAT ATTAATTACT ACTACTGGAC AACTTGCTAG TTATGGGGCT TAGCTAGGGA TCAAGTCAAA
TATTCCAGGA TTGTGCCAAT GCTGAAGACA ACTTTGGACA CGGGCATCTT TGGGATATAT CAAAAAAATT AACTGATATT
GGTTGTTTGA TTGTGTGGTT GTGAGAAACA AGAGCTAAAC CTGCTTACAT GTTAGGTACT TCCAAACAGA AGTTGTGCCA
TGCCATCACT CTATATTTTT TTCGTTTTGA AAGATCCATC ACTGATCAAA ACAGCAGAAA TTATGGAAGC CTCTTTTTGA
CCAAGATCTA GCTTTTTTAA ACAAACGCAA GAAGATGATC AAACACACCA CACACATTTC TACATACATC TCATCACCAA
AGATCTTGAG CGGATGGGTA CGTATAGAAC ACGTCATCAA CCCCCCCCCC CCCCCCCAAA CATCTCACTT TCAAGAAGAT
ATTGCTCGAG AGAAACACAC GTCATGGAGA GCTGAAAGTG GATGTACTTC CAAGAGAGCG AGAACACTAC AGCTGCATAT
TGCGTGTGAA AGACTGAAAA TCTGAAACTG TAGAGCCTGA AGAAGGGGGG AAAAGAAAAA CAGAGTGTCG ACTCCGTGTG
AAACTCTGAA CTGAAGTTAT TTTTTTTTTC GCCGGGAAGG CCGAAGGAGG CCAACCGAgt atattaagaa ggaataaaag
ttacaagaga aaaaacatca aaatacacca aggtgcattg ccacacacca cacgctacca cccaagcaca aaccgctgag
ggtgaaacct agcaccaaac gacccccgct aggcctacgg caacaccaca gagacgaggc tccgaaaacg atgccaccat
ggtggtcacg acatctagga tgccgccatc gcccatctaa aaagatctgg ttttcaccca gagaagctcg ccaagaaagg
gggagggtaa ccctcgacaa cgctccaagg agattacgac gtccgaagac gtagccgctg ccggtccggt gaaccaccgg
actaggcttt cgcctgggac cctacaacct tgactgcaga tcgccatcca ccaactcaga accaccacac agacaaatgg
cagcacgtgg catccaccat accgcaccga tgcccctccg tcggtcgact tcaacgaacc accacccctg aaagctggcc
caggactcct ccgttccacc acccgccggc cgcctcgcca gatttggccg aaggagaacc cgggactagg tggcattgct
tcggcagcct gagcttcccc cactgacgag ctgccgcctc aatccaacct agaaactccc cgcaaagaag gggaggagct
ccatgaaggc tgagggtgcc gaccggcaac gaggaagacg acccaccacc gccaactccc tttgctctgc catctggccg
ccggtggtgc tgctgctcca gaccggcacc acccgccggc gcccccgaag tccagccgtc gctcctcccc tagccaccgc
gacggcatcc cggctgcctg gcccccacgc cgagccgcCA CCGAGGCCTG GACGACCCAC CGCGCCATGG GCTGGCGCCG
GGCGACCAGG CCGAGCGAGT GAGCGGGGGT GCCCCTGCCG CTCCGGGCAG GCTGCGCTGC CCGCCGCCTC CGCGACCCGG
CCGGCCACGA CGAGCCGCGG CCATCCGCCG Cccgcgcctg ccgctgacga gccgcctcca cgtcgagccg cagtcgtccg
ccgcctccgc gcccgtgccg ggccggccta gccgcagccg gccgccgcct cgccgccttg ccgccggccg ccaccacgac
cgcatgtcgt cgcgccgccc caggcctcct cgcgccgccg ccgcgcagat ccaggcgagg gagggccgga tccggccatg
ggggctccgg atccgccgcc tcctcccctc ctcgccgccg tagctgccat ggaccacgcc ggcggggagc ttcgtcgtct
tcgactcttc gtccttcgcg cagagaaggg agacgctacg aagagaagaa ggcctcgccg ccgccttccc tgcctgctac
cggcttcgcc gccggcgggc tccagcggcg gcgaggtagg gggagggagg gagagaaggc gcgggtggct agggtttttg
cgcccccgag ccgcccgACA CGAAAGCTAT GCGCGGGGGA GGGGGGGCTG AACTGAAGTT AGGAAATTAA CAACAGaggg
tgtgtttagt tcacgctaaa attagaagtt ttgtttaaat tgaaacgatg tgacgaaaaa tttgaaagtt tgtgtatgta
ggaaagtttt gatgtgatga aaaagttaaa agtttgaaga aaaagtttgg aactaaactc ggccAGAATT TCCAGGCGTC
ACTGCCTGTA GCTTTGTATT AAATTTTAGA TGAAATCAAT TCTTTTTTTT TCCTGGGAAT GATGCGTGTG TCCAAGCTAT
AGCTTAATTA GCTAGTGGCG GTGAGCCTAT GGAGCGTTGC GAGACAGGCA TTGGCACTGT GGGAAGAAAA CGAAGGGTGG
GAGAGAGCTT GAGAAGGACA GGCAGATCCA CACAGATGGC GAGATGTATC CATATGAATA TGATAGTAAT ATGATGAACT
GTGTGGCAGC ATTGCAAAAT GCCACATGGT ACCATGGAGT AATATGCATC ACTAGAGCTA TATCATGTGG CGCATCAGTG
TCCGGGAGAA AAGGCAGGGT AGTGGGACAC ATGGAAAACG CGGTAATTTT GACAGTAACA TACTACGGTT TTAGTCAGGT
CAAGAGTTGA CAGCACGCAG CTTTAGTTAG AACTAAGTAC Tctccctccg ttctcgaata actgacacgg ttaactatag
aggtctcact ttgattacaa attactttta aataattata ttatgaattt atgaagtata ttttcaagtg tttattaaat
ttctgtaaaa ggacgagcgg tcaaaagttt aaaattatat agtggcagcg taaattattt gagaATGGGT GGATTATTTT
CTGGTCTCTA TTGGTCGTAG TAGAAGCAAT ATGAGCCGTT GATTTACAAG GGTCTTATCC TATTTTACGG GACAGTTATA
CCAGGCAATG TCTAAGTTCA ATGTATGTGC AACGATCAGT GCACATATAT ATACACACAC ACGAGTGATG AATCCTGTTG
ACTGTTGAGA CTGAGCTGTT CGGTATCTAG CGTTTTCAGG GGCTTAATTA GGTTTATTTT TCATAAAGCA TCCGTACATT
TTCTTTCTTT TCTTTTCTTT TCAATAAATT AGACACGGCC GGGCCGTCCG ACCCAATAAG TCCAAGCATG CCACTATCAC
TATGGCAGAT AACACTAGCT TGCAACGTCG CTTATGCAGA CGCCAATAAA ACTGGCATTG TTGTGCTAGC TTTTTTCTTA
AAAAAAGGAA AATTGCATTG TTGTGCTAAG CTAGGGGACG ACGCCTGCAA ATATTTCAAT GCATTATTGT GCTCTGATTG
GGCTCAACAC TCAATTACGT GTTGCTTTTT TCTGAATATA AATTATAGGA GTACAAATTA AGTACATATA TATCTGATCA
CATATTTCTC ATATTTGGGT ACTTCGACAT TGACCATCCA TCCTCCATAA TAATATTATT TTTCGTGCTA GCCAAGTACT
GATTTGGATA TATAAATGAT GAATAGGATG TTTTTGAGCA GAATTCATTG CCTGGTAATA TTTTGCAAGG AATTTAAAAC
ATAGGCCTAC TTTGAAATGG AGAAATTTTA AAGAAATGTT GCGTAAATTA AATTAACTTC TACGAAAAGC GTACAAAATT
CTTTCGTTCG AAAAGAGCTG TTCATCCCAG CGCGATTAGA CTAGTTCGTA CTACTAAAGG ATGAAGTACT AGTATGTAGT
AGGTTGAAAG TGCTTTGAAA TTCAATGTCT TTATTAGTAT TTATTTTTAT CTCGCAAGAC ATACGTGTAC ACAATATTAT
GATATCTCTA GAGTAATAGG CTCAAATGTA AAAAAGTTCA CGTGTTAATT AATTAGCAAT AAGAAAAATG TATGACATGT
CGCCCTTCCA CTTTGACATC TTGTCACTAA GTAAGCATCA ATTATACACC CCATTAAATT GATAATGACA TTCAAAAAGT
GGGATTAGAC TATATTCATC ACCATCATAA TGAGCAAACC AGACAAGTGG ATGGTGAAAA AAACAATGCA AATTTGTCAT
GCTGTGGAAA ATCTACTTGG ACCTAACATA AAAAAGCTAG AGGCTAACTG ATCCATCCAT TAACATTAAG AAAAAGACAT
ACATATGTAA AAGATAAATA GATAATTTTA TCTGATCTTC CGAGAAAGCT CTAGTTAGCC TGGATGGTTC TGTATATGAG
AGATTATATA TGTAATCTTG AGATGGTGAC AACCTAATTA ATTAATTAAT TAACAAGCAA GCATCCAGGC TAATAAACCA
GTGACTGCTA ATAAACCAGA AGTACTGTAG ACAATGCCCA TTGAGGTGTC CCTGAACAAT TTTCAGGTCT GGGTCTGCTG
GCTCTCAAAC ACTAATTAAG TCAGTAAAAA ACACCTTGTA TGTCATCGGA GATCAGATAA TTAATCTGAT TATGGTAGCC
GAATATTATA TGGCTCTGGT TCGTCTGCAA CAATAATAAT TTGGCTCCTA ATTAACTCTC AAGTTTCATG ATCAAATCCT
GGAATTCATA CTGGGGATCG TCCAAAATAT TTCCTTCAGA GTGTCTGTCA TGCCGGTGTC TTCTTCCATA ATTTTTTTTA
GTTACAAGTG TTTGTGTCGT GGAAGCAATT GAAAGTTGTT GATCAGAGAT TCAGAGACCT GATGGGTAAT TTATCTTAAG
AAACATGCAA ATATCAGTCT AGCTAGTTGA TTCAGAATCG CCATGTGTGG TAGCTATCGT GCAAGCGTGC AAATAGTTTA
GTTTTTTAAG CTACGATATG TTATTGTCAT GTGACATTTG GTAATCTTTT TTTTTTCAAT GATTTTCTTC GAAACTAGAC
AACCAGTAGT TAGACGTCAA CGCTTTGGTT TTTAATTGCA ACTAGAATAT AAATAAATTA ATTTACTAAT AATGAGGGTC
CTGTATATAG TATAAATTAT TTCCCTTGCT TGTTACGTGT GCAATTAAGT ATAAATAAAG TAGCTAGATG CATTATTATC
GATCCACATT ATCCACTTGG GTAGTAAGGC TACTTCTCAG TTCTCACAAG TGTACTACAT GCGACTATGT GAGAATCTCT
GAATATTATT GTCCCTTTCC CTCTAGTCAA ACCCTTGTTT TACAATTTAT TCTTACAATT TGTGTTCAGA ATACTAATTT
AATAGGGCTA CCATAATATG TACTTTTAGC ACTTTTTTCC TTTAAAAGTA CAATAGTATA TATCGATATA TACGACCATA
TCAGTTGACA AGTTATTTTT GCTCTTTTAA AATACAATAA GATGTTCTAT TATACAATCA TACGGGTTAA CGGATCTTTT
CCCTTTATTT GCAGGCAAGA CATTCGAAAC CCGTGACCCG CGCACCGGCG AGGTCATCGC CAAGATCGCC GAAGGAGACA
AGGCCGACAT CGACCTCGCC GTGAAGGCCG CCAGGGAGGC CTTCGACCAT GGCCCCTGGC CAAGAATGTC CGGCTTTGTA
AGCGCGCCTC TCTCCACCAT CGCCCGAAAC CCGTAAACGG GTTGGATCCA AACCCGTTAG TTAATAATAC CAGGCGGCCC
ATCTAGTTAT ACCGCACTAA TTGGGCCTAA TTAAGCCCAG CTTAACTTTG AATTTTTGGC GCCAATTAAT GGCTGCAGGC
GAGGGGAAGG ATCCTGCACA AGTTCGCGGA CCTGGTGGAG CAGCACGTGG AGGAGCTGGC GGCGCTGGAC ACGGTGGACG
CCGGCAAGCT GTTCGCGATG GGGAAGCTCG TCGACATCCC CGGCGGCGCG AACCTGCTCC GGTACTACGC CGGCGCGGCG
GACAAGGTGC ACGGCGAGAC GCTCAAGATG GCGCGGCCAT GCCACGGGTA CACGCTCAAG GAGCCCGTCG GCGTCGTCGG
CCACATCGTG CCGTGGAACT ACCCCACCAC CATGTTCTTC TTCAAGGCCa gcccggcgct cgccgccggc tgcaccatgg
tcgtcaagcc cgccgagcag acccccctct ccgcgcTCTT CTACGCCCAC CTCGCCAAGC TTGCCGGCGT CCCCGACGGC
GTGCTCAACG TCGTCCCCGG CTTCGGCCCC ACCGCCGGCG CCGCTATCTC CTCCCACATG GACATTGACA AGGTCAGATT
ACCTACTTGC CATTATGAAT TTCTGAATTC CGATTGATTA TGCTTTTTTT TTAGATAATG GATTATATTA ACCCGGCCTC
TACACCTTAG AAGGTGTACA CAGCCCAAAC CACAATCAAG AGTACATAAG ACTCCATCTA TTACACGAGG ATACCAAATA
AAAGTTTAAC AAAACGGTTA AAGAAGAACA ACAGTCTAAG CCTGATGGTT TTCACTTTTC AGGTGAGCTT CACCGGCTCG
ACGGAGGTCG GCCGGCTGGT GATGGAGGCG GCGGCGAAGA GCAACCTGAA GCCCGTCTCG CTCGAGCTGG GTGGCAAGTC
TCCGGTCATC GTGTTCGACG ACGCCGACCT CGACACGGCC GTGAACCTGG TCCACATGGC CTCCTACACC AACAAGGTCG
GCCTCTCACC GGCCATGTCG TCAGAAAACC ATCTAGCTGG CATAAGCACA ACATATTGTG AAAATCTCAT CAGCTTTCCA
CAACAATCCT GTTCTGTTGC AGGGTGAGAT CTGCGTCGCC GGCTCGCGAA TCTATGTCCA GGAGGGGATC TACGATGCGT
TCGTGAAGAA GGCGACCGAG ATGGCCAAGA AATCGGTGGT CGGAGATCCG TTCAACCCGC GAGTTCATCA AGGCCCTCAG
GTATATATAT ATGCTAGATC AGTAACCATG CTCTGATTTT TCAACTATAC AAACTTCAGA TTCAGAGAAC CAAAGATGTT
CAGCAAGCTG TAATAACCAC TTGTGTGCAA TTACAACGAA GATTGACAAG GAGCAATACG AGAAGATCCT CAAGTACATC
GACATCGGTA AGCGCGAAGG CGCGACGTTG GTCACCGGAG GGAAGCCCTG CGGCGAAAAC GGGTACTACA TCGAGCCCAC
CATCTTCACG GACGTCAAGG CATGAACATG ACCAGTGTGC TCTTCACTCC TCAGTGCTAA AATATGACCA GCAGCATTTT
CAAAGAGAAC AAAAATGCAC ATTTCCAAAT CGTGCGAAAA ACTAATAGAC CCCTTTTGCG CAGGAAGAAA TGTCGATCGC
GCAAGAGGAA ATCTTCGGGC CGGTGATGGC CCTCATGAAA TTCAAGTAGG CATCTTTTTC TGAACATTTC CAGCCTGACT
AACATCACAT GAACATCTAA CTGAAAGCCT GAAACCACTG GATCCTGAAC ATTTTTGCAC AGGACGGTTG AGGAGGCGAT
CCAGAAGGCG AACAGCACCC GGTACGGCCT GGCTGCCGGC ATAGTCACCA AGAACATCGA CGTCGCGAAC ACGGTTTCGC
GGTCGATCCG GGCAGGGGCA ATCTGGATCA ATTGCTACCT CGGCTTCGAC CCCGACGTGC CGTTCGGGGG GTACAAGATG
AGCGGCTTCG GCAAGGACAT GGGCATGGAC GCCCTTGAGA AGTACCTCCA CACCAAGGCG GTGGTCACCC CTCTCTACAA
CACCCCTTGG CTATGATCTG ATGATGAACA GCACAGAAAG ATTAATTACA GTGGAAAAAA ATAACATTTC TATATATACA
GCTGAAAGGT TGGGTTATAT TTGTGGTTAG TTGATTGCTT GTATCAAATA TCAATTTGTC GGAATAAAGA CAGTATATTT
CAGTT

Locus: Os01g0591000

Loading...

Locus: Os01g0591000

Loading...