Os01t0591300-01

Locus

Os01g0591300

Description

Similar to Cytosolic aldehyde dehydrogenase RF2D.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ALDH2C1

CGSNL Gene Name

ALDEHYDE DEHYDROGENASE 2C1

Oryzabase Gene Symbol Synonym(s)

OsALDH2C1

Oryzabase Gene Name Synonym(s)

Aldehyde dehydrogenase 2C1

Transcript Evidence

AK101427 (DDBJ, Best hit)

Protein Evidence

NP_001105047.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (GO:0016620)

Functional domain (InterPro)

Aldehyde dehydrogenase domain (IPR015590)

Aldehyde dehydrogenase, conserved site (IPR016160)

Aldehyde/histidinol dehydrogenase (IPR016161)

Aldehyde dehydrogenase, N-terminal (IPR016162)

Aldehyde dehydrogenase, C-terminal (IPR016163)

Full-length cDNA

J033038G01 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0591300-01)

RiceXPro (AK101427)

Others

Oryzabase (22110)

KEGG (Os01t0591300-01 (EC:1.2.1.3))

Transcript

1960 bp

>Os01t0591300-01 Similar to Cytosolic aldehyde dehydrogenase RF2D.
GTCCAAGAGATCTACTGTTCTCCTTGTTGAGAGGAAGCCATCCAGCCAGCTAGCTATAAG
ATAGATAGAAGAAGATCAAGACGACGACCAAGTAGAGGATAGGCATCTCTCGAAGCTTAG
AGACAAATAATTAACTAGAGATCAAGAGCCTATTCGTCGTCCATGGGGAGCACCGGCGAC
TGCGGCAATGGAAAGGCGGCCGCCGGCGGCGGCGGGTTGGTGGTGCCGGAGATCAAGTTC
ACCAAGCTCTTCATCAACGGCGAGTTCGTCGACGCCGCCTCGGGCAAGACATTCAAGACA
AGGGACCCACGAACAGGCGATGTCCTGGCCCACATCGCAGAGGCAGACAAGGCTGATGTG
GACCTCGCCGTCAAGGCCGCGAGAGAGGCCTTCGAGCACGGCAAGTGGCCCCGCATGTCA
GGCTATGAGAGGAGCAGGGTGATGAACAAGCTGGCCGACCTGGTGGAGCAGCACGCCGAC
GAGCTGGCGGCGCTGGACGGCGCCGACGCCGGGAAGCTGCTGACGCTGGGCAAGATCATC
GACATGCCCGCCGCGGCGCAGATGATGCGGTACTACGCCGGCGCGGCCGACAAGATCCAC
GGCGAGTCCCTTCGGGTGGCCGGCAAGTACCAGGGGTACACCCTCAGGGAGCCCATCGGC
GTCGTCGGCGTCATCATCCCCTGGAACTTCCCCACCATGATGTTCTTCCTCAAGGTCAGC
CCCGCCCTCGCCGCCGGCTGCACCATCGTCGTCAAGCCCGCCGAGCAGACGCCCCTCTCC
GCTCTGTACTACGCTCACCTCGCCAAGCTGGCTGGAGTTCCGGATGGAGTGATCAACGTC
GTCCCGGGATTCGGGCCGACAGCCGGTGCGGCACTCTCCTCCCACATGGACGTCGACAGT
GTTGCTTTCACTGGCTCTGCTGAAATCGGCCGTGCCATCATGGAGTCGGCGGCGCGGAGC
AACCTGAAGAATGTGTCTCTTGAGCTCGGCGGCAAGTCTCCGATGATAGTCTTCGACGAC
GCCGATGTCGACATGGCTGTCAGTCTGTCATCCCTTGCAGTTTTCTTCAACAAGGGAGAG
ATTTGCGTGGCCGGGTCACGCGTCTATGTCCAAGAAGGGATCTACGATGAGTTTGTGAAG
AAGGCCGTGGAGGCTGCCAAGAACTGGAAAGTTGGAGACCCTTTTGATGCTGCCACCAAT
ATGGGTCCTCAGGTTGACAAGGTCCAATTTGAGAGGGTTCTCAAGTACATTGAGATCGGC
AAGAACGAGGGAGCAACCCTACTCACAGGTGGCAAACCCACTGGTGACAAAGGATACTAC
ATTGAGCCTACCATATTTGTGGATGTCAAGGAGGAAATGACGATTGCGCAAGAGGAGATC
TTCGGCCCGGTGATGTCCCTCATGAAGTTCAAGACGGTGGAGGAGGCGATAGAGAAGGCC
AACTGCACCAAGTACGGGCTGGCTGCCGGCATTGTGACCAAGAACCTCAACATTGCCAAC
ATGGTGTCGAGGTCAGTGCGGGCCGGCACGGTGTGGGTGAACTGCTACTTCGCCTTCGAC
CCCGACGCGCCGTTCGGCGGGTACAAGATGAGCGGGTTCGGCCGGGACCAAGGGATGGTC
GCCATGGACAAGTACCTGCAGGTCAAGACCGTCATCACCGCCGTCCCGGACTCGCCCTGG
TACTGATAAATCAAATCAAGCAGCAGCTATAGCTAGAGTGTACCATGTACCATGAATGCT
GCAGCCTGTGTAGTGTTTTCGGATGTTTTTCTCCTTAATTCTGCTGCTGCTTGGTGTGGT
TGTATGTAGTTTGGTTGTGGGGTGAGATATGGTGCAGATTAAAAGGGGTTCTGATGATCA
TGATCTGATCCTTGTTTGGTTGAACTTGTTGAGAAATGGATGTATAGAACTCATGTGCCA
TCGTTTGAAATCGTACAAAATGTGCCTCAAAGTTCAAAGC

CDS

1524 bp

>Os01t0591300-01 Similar to Cytosolic aldehyde dehydrogenase RF2D.
ATGGGGAGCACCGGCGACTGCGGCAATGGAAAGGCGGCCGCCGGCGGCGGCGGGTTGGTG
GTGCCGGAGATCAAGTTCACCAAGCTCTTCATCAACGGCGAGTTCGTCGACGCCGCCTCG
GGCAAGACATTCAAGACAAGGGACCCACGAACAGGCGATGTCCTGGCCCACATCGCAGAG
GCAGACAAGGCTGATGTGGACCTCGCCGTCAAGGCCGCGAGAGAGGCCTTCGAGCACGGC
AAGTGGCCCCGCATGTCAGGCTATGAGAGGAGCAGGGTGATGAACAAGCTGGCCGACCTG
GTGGAGCAGCACGCCGACGAGCTGGCGGCGCTGGACGGCGCCGACGCCGGGAAGCTGCTG
ACGCTGGGCAAGATCATCGACATGCCCGCCGCGGCGCAGATGATGCGGTACTACGCCGGC
GCGGCCGACAAGATCCACGGCGAGTCCCTTCGGGTGGCCGGCAAGTACCAGGGGTACACC
CTCAGGGAGCCCATCGGCGTCGTCGGCGTCATCATCCCCTGGAACTTCCCCACCATGATG
TTCTTCCTCAAGGTCAGCCCCGCCCTCGCCGCCGGCTGCACCATCGTCGTCAAGCCCGCC
GAGCAGACGCCCCTCTCCGCTCTGTACTACGCTCACCTCGCCAAGCTGGCTGGAGTTCCG
GATGGAGTGATCAACGTCGTCCCGGGATTCGGGCCGACAGCCGGTGCGGCACTCTCCTCC
CACATGGACGTCGACAGTGTTGCTTTCACTGGCTCTGCTGAAATCGGCCGTGCCATCATG
GAGTCGGCGGCGCGGAGCAACCTGAAGAATGTGTCTCTTGAGCTCGGCGGCAAGTCTCCG
ATGATAGTCTTCGACGACGCCGATGTCGACATGGCTGTCAGTCTGTCATCCCTTGCAGTT
TTCTTCAACAAGGGAGAGATTTGCGTGGCCGGGTCACGCGTCTATGTCCAAGAAGGGATC
TACGATGAGTTTGTGAAGAAGGCCGTGGAGGCTGCCAAGAACTGGAAAGTTGGAGACCCT
TTTGATGCTGCCACCAATATGGGTCCTCAGGTTGACAAGGTCCAATTTGAGAGGGTTCTC
AAGTACATTGAGATCGGCAAGAACGAGGGAGCAACCCTACTCACAGGTGGCAAACCCACT
GGTGACAAAGGATACTACATTGAGCCTACCATATTTGTGGATGTCAAGGAGGAAATGACG
ATTGCGCAAGAGGAGATCTTCGGCCCGGTGATGTCCCTCATGAAGTTCAAGACGGTGGAG
GAGGCGATAGAGAAGGCCAACTGCACCAAGTACGGGCTGGCTGCCGGCATTGTGACCAAG
AACCTCAACATTGCCAACATGGTGTCGAGGTCAGTGCGGGCCGGCACGGTGTGGGTGAAC
TGCTACTTCGCCTTCGACCCCGACGCGCCGTTCGGCGGGTACAAGATGAGCGGGTTCGGC
CGGGACCAAGGGATGGTCGCCATGGACAAGTACCTGCAGGTCAAGACCGTCATCACCGCC
GTCCCGGACTCGCCCTGGTACTGA

Protein

508 aa

>Os01t0591300-01 Similar to Cytosolic aldehyde dehydrogenase RF2D.
MGSTGDCGNGKAAAGGGGLVVPEIKFTKLFINGEFVDAASGKTFKTRDPRTGDVLAHIAE
ADKADVDLAVKAAREAFEHGKWPRMSGYERSRVMNKLADLVEQHADELAALDGADAGKLL
TLGKIIDMPAAAQMMRYYAGAADKIHGESLRVAGKYQGYTLREPIGVVGVIIPWNFPTMM
FFLKVSPALAAGCTIVVKPAEQTPLSALYYAHLAKLAGVPDGVINVVPGFGPTAGAALSS
HMDVDSVAFTGSAEIGRAIMESAARSNLKNVSLELGGKSPMIVFDDADVDMAVSLSSLAV
FFNKGEICVAGSRVYVQEGIYDEFVKKAVEAAKNWKVGDPFDAATNMGPQVDKVQFERVL
KYIEIGKNEGATLLTGGKPTGDKGYYIEPTIFVDVKEEMTIAQEEIFGPVMSLMKFKTVE
EAIEKANCTKYGLAAGIVTKNLNIANMVSRSVRAGTVWVNCYFAFDPDAPFGGYKMSGFG
RDQGMVAMDKYLQVKTVITAVPDSPWY*

5'UTR

chr01:23113647..23113808 (+ strand) : 162 bp

CDS

chr01:23113809..23113929 (+ strand) : 121 bp

chr01:23117252..23117394 (+ strand) : 143 bp

chr01:23117515..23117898 (+ strand) : 384 bp

chr01:23118019..23118108 (+ strand) : 90 bp

chr01:23118199..23118372 (+ strand) : 174 bp

chr01:23118497..23118634 (+ strand) : 138 bp

chr01:23118773..23118910 (+ strand) : 138 bp

chr01:23118983..23119044 (+ strand) : 62 bp

chr01:23119157..23119430 (+ strand) : 274 bp

3'UTR

chr01:23119431..23119704 (+ strand) : 274 bp

FASTA

>Os01t0591300-01 class=Sequence position=chr01:23113647..23119704 (+ strand)
GTCCAAGAGA TCTACTGTTC TCCTTGTTGA GAGGAAGCCA TCCAGCCAGC TAGCTATAAG ATAGATAGAA GAAGATCAAG
ACGACGACCA AGTAGAGGAT AGGCATCTCT CGAAGCTTAG AGACAAATAA TTAACTAGAG ATCAAGAGCC TATTCGTCGT
CCATGGGGAG CACCGGCGAC TGCGGCAATG GAAAGGCGGC CGCCGGCGGC GGCGGGTTGG TGGTGCCGGA GATCAAGTTC
ACCAAGCTCT TCATCAACGG CGAGTTCGTC GACGCCGCCT CGGGTAATAC ATAGATATAT GCCTCATCGT CATTGATTAA
CTTAATTAAT TAATTAATTA ATTAATTCCC ATGGTTTCTT TACAAGATAG GCGTACTGCT ACACGTTTCA TCGTCTTTGA
TTATAATTTT TCATCCTTAT GTGTGTTTCT ACCCATTCTC TTTCCAGCTA TCTGATACGA GAAATTTAAT TTACCATACC
CGAGGTACCA GTACTTAGGA TATTTAGGAA GTACCAAAGT TTATATAAAA AATATGATAC CAATACAACT TAATTCAGAA
CTGTCTCTAA TATTTATAGG AAACTATTTA AGCTCTCGAC AATTCCGTAC CATTTTTTTT TTACATTTTC TTTGGAAAAT
ATGATAAATT TAACCGGCCT CTACAAATTA ATAGTTATGA ACAATCCTGC AATATATATA TATATATATA TATATATATA
TATATATATA GTTATGAACA ATTTTGTCAC GTATATTAGT ATTTTACCGT ATACGCACTG TCGTTGTCGT CGTCAGCCAA
CTGATCAAAA TCTCTCCCAA GGAAAACTAA CGGCTTAACA TCGAGCATGG AATGCAAACG ATATGATGGT ACTCTGTTGA
CGAACTAATT TATTGGAGTT AACTCATGCT CGATTTCTTG CATAAAAATT AGAGAAATAT GTAGGTACGT ACGTGTATGA
ATATAATGTA CAAATATGTA GGTACGTATG AATATGATGT ACTGCGTGTT GCTATAGAGC TGAGGCGGTT TTTGTTTTGT
TTTTTTTGTT TTGAAAATAG CCGCTAGCTA GCTAGCTTTC TCTTCAATTC TCGCGGTCTC CTGAAAATGA AAGAAAGAGT
ATGTTCCAAC ATGGAAAACT CTCGACGACC GATCTAATAC TGAAAATTAA AGAGGAGGTT AAAACTTAAA CCTTACGGGG
GCAAAGAATC TAACTGCTCT GGATCTAGCT AGCTGTACTA TATTTTCACA AATTTCTCCT GTTCTATTTA ATAAAATTGG
TGGCTCATGA TTCGTTAAAC AAAAAAAAGG AATTCTTGCT GCCTCCATCA AAACATTAAA CGACCATCCA TGTCCATGAA
CCCTTGTACT AACGGTACAC CACACATTTA TATCATTTAT ATCAGTTACC ATATACGTAA GTAGCCATGT CTGCTGGTGG
TTAATTTATT GCAATAATAT AACCTATAGT GTTTTATATG TTATTTCTTT CTCTCTTTAT TCTTTTTGCA TCATATATAT
CATTCATCAG AAGTAGTTAA TTAATTAAAT TAAAGCGTAA TTCCTATAGT TTTTTTAATT CGGTGTTATT TATTTTCTCT
TAATTATTAT ATATTTTCTT TTACATCATT CATCACAAGT ATATAAAGCA TGAATGAAAC AAAGTTTTGC GTCATGCATG
AGTCATGTAC TTTGGCATTA TGAAATGAGC ACATGATATT GACTCTTAGA CGTGGTTGCA TCCGTAGAAA CAGGAGGCCA
GATCGAAGCC AAGTCAAAAC GGTTGTGTAC GTTCTATATG TCTCGCTCCC AGCTATACAG ATATCTACAA ATAATAAAGA
ATATATTTTT GTTTATCTCC TTAGCTAAGC TAGCATTAGC AGCCGGCCAG CACAGCACAC ATGACAAGCT AGCtattccc
tccgatttta atatataaca actttttagg acacacattt gtttgactat ttgtcagatt taaaattgtg tgtaaacata
aaaaaaatac aagttattct taaagtatat atataatgat aaaataaata ataaccttat gattttttaa aataagatga
atggttatgt ttaaatgtcA ATTGTGCCAA ATCGGAGAGG GTATTAGCTA GCTACTACAT GAAGCACCAT GAATCGTACG
TCAAGTGGCC AAACGTGGCG TGCACTGCGA TTGCAAATTA AGGCAGTTAA AAAAATTTTG GTTTCTTTGT AGGGGGAATA
GCTTTATTTA TTTACAAGAG AAAACAAATT ATCCAGCATT TATTATGCCC TCAGAAAAAT ATCCACCCTA AAAATGGAAA
AAGGGAATCA ATGTGAGTGT GGCTCCACGT AGACATGACG TCATGGTGAG AGGGAACAGC TTTGACTAGT CATAAATATC
TTCCATTCTC GTGGGATTCT GTTCATAATC CTCGGCATTC CCTCATTGTG CCACTAACAA AATGGACCTT GCTTTCAAAA
AAAAAAAAAA GATGGACCAA GAAGGTCCTG TCGGTACAAA ACTTTGAAAA ATCTCAAATT GTTCTTCCTC TATTTGGATT
GGCCATTGCA ACCGATCAAA GTTGAAAATT TTGATCAGTG TCTTGTACTC TTGTACCact tctgtcccat aataattata
tttctagaat tcaaattatc tcaaatggtt ttcgtaataa agtacaaatt atctcatcaa tcacttccca ttcaaattcc
tccatatttt actctcaagc accctcccac ttttacatat gcaccattga atgagagaca tcatagtttt tcttctctgt
atcatatata agtcatttca cttttttagt taaatttctt tgagtttgac cgagtttata taaaaatata gtaacatttt
caatgcaaaa caaacatatt atcaaaatat attcaatgtt agatttaatg aaactaattt ggcattgtag atgttgctaa
tattttctat aaacttggtc aaacctaaac aactttgact aagaaaagtg tcaaacgatt tataatatga agcagagaga
gtaTATGATA AGATAATTTA GAATTACAAT TACTTCGGGA CGAAGGTAAT ATCAAAATTA GGGTTTACAA GAATGGAAAT
AATGTTCACT CTATTAAAGT GTTTGACTTT TTCAACTTTT CTAAAAATAT TTGCCACGGT CTTTTCTTTT CCTCTTATGT
TTGTGTGAAG TGGATACTTC ACTCTCGTGA TAAATCAAGT CATACTTTTT CAACTGAAAA TAGTTATCTC TACCACTTTA
AAAGTGCAGT CGTCCTCCTT CTGTTCTCTG TCCATCATTC CACCTAGGGT CCAGCATTTT ATTCTCGATC CACCTATCGA
GCCAACCCCT AATTATATGG GCCTAGCCTG TGCTTTATTC TTAATCCACC CACTCAGCTA ATCTCAAAGG TCTGGCCCTA
TATTACTACT AAGGAAAAAA ATGATGGTGC AAAGAGATAA ACTAAAAGAC ATCACCCAAA GGACCATGGA AAAACTCAAA
ATGTTAATCT CTATCTCCTT AAATCTTGTT TCAAGAACGA AAACGGACAA ATGTAATTGT TTCTATGTGG ATTTGATTTT
TACAGGCAAG ACATTCAAGA CAAGGGACCC ACGAACAGGC GATGTCCTGG CCCACATCGC AGAGGCAGAC AAGGCTGATG
TGGACCTCGC CGTCAAGGCC GCGAGAGAGG CCTTCGAGCA CGGCAAGTGG CCCCGCATGT CAGGCTATGT ACGTGTTTCC
ACTCCCATAT GATCTTCTTC AGAGCCAAAT TTTACAAGTT CGTCCAATTT ACTGTATGGT ACTGTAGCTT GTCCGACAAA
ATCCACAAAC AATGTTGCCG TCACGCAGGA GAGGAGCAGG GTGATGAACA AGCTGGCCGA CCTGGTGGAG CAGCACGCCG
ACGAGCTGGC GGCGCTGGAC GGCGCCGACG CCGGGAAGCT GCTGACGCTG GGCAAGATCA TCGACATGCC CGCCGCGGCG
CAGATGATGC GGTACTACGC CGGCGCGGCC GACAAGATCC ACGGCGAGTC CCTTCGGGTG GCCGGCAAGT ACCAGGGGTA
CACCCTCAGG GAGCCCATCG GCGTCGTCGG CGTCATCATC CCCTGGAACT TCCCCACCAT GATGTTCTTC CTCAAGGTCA
GCCCCGCCCT CGCCGCCGGC TGCACCATCG TCGTCAAGCC CGCCGAGCAG ACGCCCCTCT CCGCTCTGTA CTACGCTCAC
CTCGCCAAGC TGGTAACCAA TGTTCAAACC AAATCCACCC TTTTGTTTTC ATGCCTGCTT TTCTTCTTGT TCTTGAGTTG
ATTTTCTAGA ATTTGGATGA TAATTCAGTG TACCTTTGAT ATCATCATTC AGGCTGGAGT TCCGGATGGA GTGATCAACG
TCGTCCCGGG ATTCGGGCCG ACAGCCGGTG CGGCACTCTC CTCCCACATG GACGTCGACA GTGTGAGCAC TCCGATCACC
ATCTGGTACT GTAGCGTTTC AGGTTTTTGT CTGAATGAGT TTCTGACCGA AATGTTGTTG TGCATATGTC AGGTTGCTTT
CACTGGCTCT GCTGAAATCG GCCGTGCCAT CATGGAGTCG GCGGCGCGGA GCAACCTGAA GAATGTGTCT CTTGAGCTCG
GCGGCAAGTC TCCGATGATA GTCTTCGACG ACGCCGATGT CGACATGGCT GTCAGTCTGT CATCCCTTGC AGTTTTCTTC
AACAAGGTAA CTAAATGCAC TATGCACCGG ACCAAGGTTC AGAAATGTTC AGGTTAGGAG TGTTCAGTTC AGACTCTGAA
CTTCAGAGCA AAAAAAAACT GACCGTGCTA CTGGCGTCTG AAATTTTCAG GGAGAGATTT GCGTGGCCGG GTCACGCGTC
TATGTCCAAG AAGGGATCTA CGATGAGTTT GTGAAGAAGG CCGTGGAGGC TGCCAAGAAC TGGAAAGTTG GAGACCCTTT
TGATGCTGCC ACCAATATGG GTCCTCAGGT AATATTATCC TACTATTTTC ATATTTTTGT TCTGAAACAT TTTCTGTCGA
AATGCGAGCA ATGGAAGAAA AAACATTGAG ATGACAAAAT GGACAATTGT ATCAGAACTT ATGAACATTA TGTTTTCATT
TGCTAGGTTG ACAAGGTCCA ATTTGAGAGG GTTCTCAAGT ACATTGAGAT CGGCAAGAAC GAGGGAGCAA CCCTACTCAC
AGGTGGCAAA CCCACTGGTG ACAAAGGATA CTACATTGAG CCTACCATAT TTGTGGATGT CAAGGTAACC AGCTTACATT
TAGAAGCACA ATCAAATCAA ATCAACAATG CTCATCTGGG TTGATCCTCC ATGCAGGAGG AAATGACGAT TGCGCAAGAG
GAGATCTTCG GCCCGGTGAT GTCCCTCATG AAGTTCAAGT CAGTACTCAA AAACCTCACA AGTTTCGATG ATCTGATCTC
ATCTCCAAAA CAAACAAAAA AAAACATTCT GAAAACTTGA CTTATGATCT GAACTTTTTT TTTTCTTCAG GACGGTGGAG
GAGGCGATAG AGAAGGCCAA CTGCACCAAG TACGGGCTGG CTGCCGGCAT TGTGACCAAG AACCTCAACA TTGCCAACAT
GGTGTCGAGG TCAGTGCGGG CCGGCACGGT GTGGGTGAAC TGCTACTTCG CCTTCGACCC CGACGCGCCG TTCGGCGGGT
ACAAGATGAG CGGGTTCGGC CGGGACCAAG GGATGGTCGC CATGGACAAG TACCTGCAGG TCAAGACCGT CATCACCGCC
GTCCCGGACT CGCCCTGGTA CTGATAAATC AAATCAAGCA GCAGCTATAG CTAGAGTGTA CCATGTACCA TGAATGCTGC
AGCCTGTGTA GTGTTTTCGG ATGTTTTTCT CCTTAATTCT GCTGCTGCTT GGTGTGGTTG TATGTAGTTT GGTTGTGGGG
TGAGATATGG TGCAGATTAA AAGGGGTTCT GATGATCATG ATCTGATCCT TGTTTGGTTG AACTTGTTGA GAAATGGATG
TATAGAACTC ATGTGCCATC GTTTGAAATC GTACAAAATG TGCCTCAAAG TTCAAAGC

Locus: Os01g0591300

Loading...

Locus: Os01g0591300

Loading...