Os01t0591300-02

Locus

Os01g0591300

Description

Similar to aldehyde dehydrogenase5.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ALDH2C1

CGSNL Gene Name

ALDEHYDE DEHYDROGENASE 2C1

Oryzabase Gene Symbol Synonym(s)

OsALDH2C1

Oryzabase Gene Name Synonym(s)

Aldehyde dehydrogenase 2C1

Transcript Evidence

AK240813 (DDBJ, Best hit)

Protein Evidence

NP_001105047.1 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (GO:0016620)

Functional domain (InterPro)

Aldehyde dehydrogenase domain (IPR015590)

Aldehyde/histidinol dehydrogenase (IPR016161)

Aldehyde dehydrogenase, C-terminal (IPR016163)

Full-length cDNA

J065008C04 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0591300-02)

Others

Oryzabase (22110)

Transcript

1779 bp

>Os01t0591300-02 Similar to aldehyde dehydrogenase5.
TCAGAACTTATGAACATTATGTTTTCATTTGCTAGGTTGACAAGGTCCAATTTGAGAGGG
TTCTCAAGTACATTGAGATCGGCAAGAACGAGGGAGCAACCCTACTCACAGGTGGCAAAC
CCACTGGTGACAAAGGATACTACATTGAGCCTACCATATTTGTGGATGTCAAGGTAACCA
GCTTACATTTAGAAGCACAATCAAATCAAATCAACAATGCTCATCTGGGTTGATCCTCCA
TGCAGGAGGAAATGACGATTGCGCAAGAGGAGATCTTCGGCCCGGTGATGTCCCTCATGA
AGTTCAAGTCAGTACTCAAAAACCTCACAAGTTTCGATGATCTGATCTCATCTCCAAAAC
AAACAAAAAAAAACATTCTGAAAACTTGACTTATGATCTGAACTTTTTTTTTTCTTCAGG
ACGGTGGAGGAGGCGATAGAGAAGGCCAACTGCACCAAGTACGGGCTGGCTGCCGGCATT
GTGACCAAGAACCTCAACATTGCCAACATGGTGTCGAGGTCAGTGCGGGCCGGCACGGTG
TGGGTGAACTGCTACTTCGCCTTCGACCCCGACGCGCCGTTCGGCGGGTACAAGATGAGC
GGGTTCGGCCGGGACCAAGGGATGGTCGCCATGGACAAGTACCTGCAGGTCAAGACCGTC
ATCACCGCCGTCCCGGACTCGCCCTGGTACTGATAAATCAAATCAAGCAGCAGCTATAGC
TAGAGTGTACCATGTACCATGAATGCTGCAGCCTGTGTAGTGTTTTCGGATGTTTTTCTC
CTTAATTCTGCTGCTGCTTGGTGTGGTTGTATGTAGTTTGGTTGTGGGGTGAGATATGGT
GCAGATTAAAAGGGGTTCTGATGATCATGATCTGATCCTTGTTTGGTTGAACTTGTTGAG
AAATGGATGTATAGAACTCATGTGCCATCGTTTGAAATCGTACAAAATGTGCCTCAAAGT
TCAAAGCAGGTTGGATTATTCGAACGGGGTACTGTGCCCTGAGCCCCTGACCGCCTTGTT
CGGTATGGAAGGGGTTGAAGGggtttggagggatttgagggggaataattccacaccaca
ataggtgtggaataaatcccctccaatccctctctcttggggattaaccgaacaTAGCAT
TAACAGTATGACTGGAGTTGTTTTAATTGTGTTCTCTGATAAATGGCCAGAGCCAGATGC
AAGAATGAATACTGAGCAATACCATTAGGACGAATGCATGACGGTCTCAAGTTGAAAACG
GATGATATAGGCAGATATATAAGCACTCATAGAAACAACAGGAAACTTCTTAAAATATTT
GCCACGCATTTCAGGGCATCGTGATATGCTACCGAACTTTTGGTTTCCATTAGTCAGATG
AAAATTCCATGTCCTGTTTTGCCGAGCCATGTTTTTTTTTTCCGAAAGAAGAAGAAGAAA
AACCAAAGTAGGAATTTTGTACAATAACTTTTGTTGCACAGAAATCATCTTATTGGTTTG
GCATTCATTTCTGTAAATCAAAACATACCATATTCATTTCTAAGTTATGCACACACTCGA
TTAGCAAGAGAAAATAATATTGCCTCAAAATATAAACAGTTTTAGGGTTGGACACGATGT
TGATGGGCTATACCCATAACATGATAATTTGATTTAATCTATCATAAACTAGTGGTAATT
TGATGCATATTATGAAGTCTAATCTTACCAGTCTGAGGATGAACTGTCGAGGGTCAAGTC
GAGGATGACGAGCGGACGAGGAGGGGGAAAGCAGGAGCC

CDS

297 bp

>Os01t0591300-02 Similar to aldehyde dehydrogenase5.
TCTGAACTTTTTTTTTTCTTCAGGACGGTGGAGGAGGCGATAGAGAAGGCCAACTGCACC
AAGTACGGGCTGGCTGCCGGCATTGTGACCAAGAACCTCAACATTGCCAACATGGTGTCG
AGGTCAGTGCGGGCCGGCACGGTGTGGGTGAACTGCTACTTCGCCTTCGACCCCGACGCG
CCGTTCGGCGGGTACAAGATGAGCGGGTTCGGCCGGGACCAAGGGATGGTCGCCATGGAC
AAGTACCTGCAGGTCAAGACCGTCATCACCGCCGTCCCGGACTCGCCCTGGTACTGA

Protein

99 aa

>Os01t0591300-02 Similar to aldehyde dehydrogenase5.
SELFFFFRTVEEAIEKANCTKYGLAAGIVTKNLNIANMVSRSVRAGTVWVNCYFAFDPDA
PFGGYKMSGFGRDQGMVAMDKYLQVKTVITAVPDSPWY*

5'UTR

chr01:23118738..23119133 (+ strand) : 396 bp

CDS

chr01:23119134..23119430 (+ strand) : 297 bp

3'UTR

chr01:23119431..23120516 (+ strand) : 1086 bp

FASTA

>Os01t0591300-02 class=Sequence position=chr01:23118738..23120516 (+ strand)
TCAGAACTTA TGAACATTAT GTTTTCATTT GCTAGGTTGA CAAGGTCCAA TTTGAGAGGG TTCTCAAGTA CATTGAGATC
GGCAAGAACG AGGGAGCAAC CCTACTCACA GGTGGCAAAC CCACTGGTGA CAAAGGATAC TACATTGAGC CTACCATATT
TGTGGATGTC AAGGTAACCA GCTTACATTT AGAAGCACAA TCAAATCAAA TCAACAATGC TCATCTGGGT TGATCCTCCA
TGCAGGAGGA AATGACGATT GCGCAAGAGG AGATCTTCGG CCCGGTGATG TCCCTCATGA AGTTCAAGTC AGTACTCAAA
AACCTCACAA GTTTCGATGA TCTGATCTCA TCTCCAAAAC AAACAAAAAA AAACATTCTG AAAACTTGAC TTATGATCTG
AACTTTTTTT TTTCTTCAGG ACGGTGGAGG AGGCGATAGA GAAGGCCAAC TGCACCAAGT ACGGGCTGGC TGCCGGCATT
GTGACCAAGA ACCTCAACAT TGCCAACATG GTGTCGAGGT CAGTGCGGGC CGGCACGGTG TGGGTGAACT GCTACTTCGC
CTTCGACCCC GACGCGCCGT TCGGCGGGTA CAAGATGAGC GGGTTCGGCC GGGACCAAGG GATGGTCGCC ATGGACAAGT
ACCTGCAGGT CAAGACCGTC ATCACCGCCG TCCCGGACTC GCCCTGGTAC TGATAAATCA AATCAAGCAG CAGCTATAGC
TAGAGTGTAC CATGTACCAT GAATGCTGCA GCCTGTGTAG TGTTTTCGGA TGTTTTTCTC CTTAATTCTG CTGCTGCTTG
GTGTGGTTGT ATGTAGTTTG GTTGTGGGGT GAGATATGGT GCAGATTAAA AGGGGTTCTG ATGATCATGA TCTGATCCTT
GTTTGGTTGA ACTTGTTGAG AAATGGATGT ATAGAACTCA TGTGCCATCG TTTGAAATCG TACAAAATGT GCCTCAAAGT
TCAAAGCAGG TTGGATTATT CGAACGGGGT ACTGTGCCCT GAGCCCCTGA CCGCCTTGTT CGGTATGGAA GGGGTTGAAG
Gggtttggag ggatttgagg gggaataatt ccacaccaca ataggtgtgg aataaatccc ctccaatccc tctctcttgg
ggattaaccg aacaTAGCAT TAACAGTATG ACTGGAGTTG TTTTAATTGT GTTCTCTGAT AAATGGCCAG AGCCAGATGC
AAGAATGAAT ACTGAGCAAT ACCATTAGGA CGAATGCATG ACGGTCTCAA GTTGAAAACG GATGATATAG GCAGATATAT
AAGCACTCAT AGAAACAACA GGAAACTTCT TAAAATATTT GCCACGCATT TCAGGGCATC GTGATATGCT ACCGAACTTT
TGGTTTCCAT TAGTCAGATG AAAATTCCAT GTCCTGTTTT GCCGAGCCAT GTTTTTTTTT TCCGAAAGAA GAAGAAGAAA
AACCAAAGTA GGAATTTTGT ACAATAACTT TTGTTGCACA GAAATCATCT TATTGGTTTG GCATTCATTT CTGTAAATCA
AAACATACCA TATTCATTTC TAAGTTATGC ACACACTCGA TTAGCAAGAG AAAATAATAT TGCCTCAAAA TATAAACAGT
TTTAGGGTTG GACACGATGT TGATGGGCTA TACCCATAAC ATGATAATTT GATTTAATCT ATCATAAACT AGTGGTAATT
TGATGCATAT TATGAAGTCT AATCTTACCA GTCTGAGGAT GAACTGTCGA GGGTCAAGTC GAGGATGACG AGCGGACGAG
GAGGGGGAAA GCAGGAGCC

Locus: Os01g0591300

Loading...

Locus: Os01g0591300

Loading...