Os01t0606900-01

Locus

Os01g0606900

Description

Heat shock protein DnaJ, N-terminal domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

BPH33

CGSNL Gene Name

BROWN PLANTHOPPER RESISTANCE 33

Oryzabase Gene Symbol Synonym(s)

OsDjC10, DjC10, Bph33(t), Bph33

Oryzabase Gene Name Synonym(s)

DnaJ domain protein C10

Transcript Evidence

AK065697 (DDBJ, Best hit)

Protein Evidence

NP_001151849.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, N-terminal (IPR001623)

Heat shock protein DnaJ (IPR003095)

Heat shock protein DnaJ, conserved site (IPR018253)

Full-length cDNA

J013037L21 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0606900-01)

RiceXPro (AK065697)

Others

Oryzabase (12167)

KEGG (Os01t0606900-01)

Transcript

1214 bp

>Os01t0606900-01 Heat shock protein DnaJ, N-terminal domain containing protein.
GAGGCCTCTCCTCGACGTCGCCCGTACATTCTCCAGCCGCGCCATCGTTCTTTCACTTCA
CCCCCAATGTTGTTCTAGCCCCCGCGCCACCCAAGATAGATAGATTCATCGCGATCGATC
GAGCGGGAGGTAGAGACTAGAGAGGGATAGTGTGTGCTGCTGCTGCTGCGTCGGAGTAGG
ATATCGCGATCGATCGGTCGATCGGGCGGATGCAGCAGGGGAGGGGGAGGAGGAGGATGA
TGCAGGGATCGTCGTACTACGCCGTGCTCGGCGTTCACCCCGGCGCGTCCGCCGCCGAGA
TACGCGCCGCGTACCACCGCCTCGCCATGAAGTGGCACCCGGACAAGATCACCAGCGGCC
GCGTGGATGCGGAGGAAGCCAAGAGCAGGTTCCAGCAGGTGCACGAGGCGTACCAAGTGT
TGTCTGACGAGAAGAGGAGGGCGCTCTACGACTCAGGCATGTACGACCCGCTCGACGACG
ACCAGGAGGAGGACGTCGAGGGCTTCCACGACTTCCTCCAGGAGATGGTGTCCCTCATGG
CCACGGTAGGAAGAGAGGAGCCCGTGTACTGCCTGGACGAGCTCCGCTCCATGCTGGACG
GGATGATGCAGGATTTCGCCTCGTCCGAATTGCCTTCGCCCAGCGGCGGCTTCTTCGCCG
GCGCGCCCTCCTCGCCGTTCGCCGACACCGGCGCCGCGCAGCAGCAGCGCGGGGTCGGCT
CCGCCTCCGCGCGCGCGCACGCTCATCCCCAGGTGGTCGGCAACTCTGCCTGCCTCAGCC
GGATGGCCTTCTCCAGCTACTGAGATCAATTTTTGCCAGCGGCCGCAACATCATCACCTG
CATAGATTAGCTAGCCTCGTCGACATCGAGTGAGAGTGAGTAGTCGGCGGCGGTGCGGCG
CCGCCCCCTGCTGCCGATGAGGCGCGTCAGCGTCGTGATCTCATGAAGGTGCATGCAGAA
AGGTGGCAAGGCAGGGCACTGGAACAAAGTATTTCTGTTTATTTTCTTGTCTTGTTTCGA
TGGGATGGGCTCTGCAGCGAGAACTGTCTATACTGTTCCGAGTGTACCGTGACAATGTGA
TATCACGGGACTGTTTGCCTTTGTACAGTTTCATGATAAACAATCTGAAGTAGTAGTAAT
GAACTAGTGACAATGATGATGATGATCGTCGTTGTTCCGTTCTGTTAGGATGATGGGACG
ATCCCTTTGGTGTG

CDS

594 bp

>Os01t0606900-01 Heat shock protein DnaJ, N-terminal domain containing protein.
ATGCAGCAGGGGAGGGGGAGGAGGAGGATGATGCAGGGATCGTCGTACTACGCCGTGCTC
GGCGTTCACCCCGGCGCGTCCGCCGCCGAGATACGCGCCGCGTACCACCGCCTCGCCATG
AAGTGGCACCCGGACAAGATCACCAGCGGCCGCGTGGATGCGGAGGAAGCCAAGAGCAGG
TTCCAGCAGGTGCACGAGGCGTACCAAGTGTTGTCTGACGAGAAGAGGAGGGCGCTCTAC
GACTCAGGCATGTACGACCCGCTCGACGACGACCAGGAGGAGGACGTCGAGGGCTTCCAC
GACTTCCTCCAGGAGATGGTGTCCCTCATGGCCACGGTAGGAAGAGAGGAGCCCGTGTAC
TGCCTGGACGAGCTCCGCTCCATGCTGGACGGGATGATGCAGGATTTCGCCTCGTCCGAA
TTGCCTTCGCCCAGCGGCGGCTTCTTCGCCGGCGCGCCCTCCTCGCCGTTCGCCGACACC
GGCGCCGCGCAGCAGCAGCGCGGGGTCGGCTCCGCCTCCGCGCGCGCGCACGCTCATCCC
CAGGTGGTCGGCAACTCTGCCTGCCTCAGCCGGATGGCCTTCTCCAGCTACTGA

Protein

198 aa

>Os01t0606900-01 Heat shock protein DnaJ, N-terminal domain containing protein.
MQQGRGRRRMMQGSSYYAVLGVHPGASAAEIRAAYHRLAMKWHPDKITSGRVDAEEAKSR
FQQVHEAYQVLSDEKRRALYDSGMYDPLDDDQEEDVEGFHDFLQEMVSLMATVGREEPVY
CLDELRSMLDGMMQDFASSELPSPSGGFFAGAPSSPFADTGAAQQQRGVGSASARAHAHP
QVVGNSACLSRMAFSSY*

5'UTR

chr01:23911517..23911725 (+ strand) : 209 bp

CDS

chr01:23911726..23911845 (+ strand) : 120 bp

chr01:23911966..23912053 (+ strand) : 88 bp

chr01:23912171..23912253 (+ strand) : 83 bp

chr01:23912376..23912432 (+ strand) : 57 bp

chr01:23912583..23912828 (+ strand) : 246 bp

3'UTR

chr01:23912829..23913239 (+ strand) : 411 bp

FASTA

>Os01t0606900-01 class=Sequence position=chr01:23911517..23913239 (+ strand)
GAGGCCTCTC CTCGACGTCG CCCGTACATT CTCCAGCCGC GCCATCGTTC TTTCACTTCA CCCCCAATGT TGTTCTAGCC
CCCGCGCCAC CCAAGATAGA TAGATTCATC GCGATCGATC GAGCGGGAGG TAGAGACTAG AGAGGGATAG TGTGTGCTGC
TGCTGCTGCG TCGGAGTAGG ATATCGCGAT CGATCGGTCG ATCGGGCGGA TGCAGCAGGG GAGGGGGAGG AGGAGGATGA
TGCAGGGATC GTCGTACTAC GCCGTGCTCG GCGTTCACCC CGGCGCGTCC GCCGCCGAGA TACGCGCCGC GTACCACCGC
CTCGCCATGG TGAGTGCGAT TCTGCAACAC ACCCGGTCTG GTTTTCCTGT GGTTTGGTTT CGCCGGAGTT GGAAGCAGAG
CATCTGAGCA TATATGGCGC TGACGTGATT TGGGATTTGG TGCGTGCAGA AGTGGCACCC GGACAAGATC ACCAGCGGCC
GCGTGGATGC GGAGGAAGCC AAGAGCAGGT TCCAGCAGGT GCACGAGGCG TACCAAGGTA ATCAAAAAGC ACAAATCCTC
TGTTTCTCGT GCGTGTCCTC TGCAATCTGC ATCATCTTCT TCGGACGAAT TTCTGAATAC GAATTTTTTT TTTGTCTGTC
GCGTGCGAAT GCAGTGTTGT CTGACGAGAA GAGGAGGGCG CTCTACGACT CAGGCATGTA CGACCCGCTC GACGACGACC
AGGAGGAGGA CGTCGAGGTA ATCCACTAAG CATCAAACTT TTCTCATGCG TGCTTTGCTT CTTTTTCTTT TTTTTTTTTG
ATATTGCGAT GGTTTTTGTG ATCTAACTTG CTGATTTGCT TACCTTGCGA CACCACCAGG GCTTCCACGA CTTCCTCCAG
GAGATGGTGT CCCTCATGGC CACGGTAGGA AGAGAGGTAA TTAAATTTGA TGACCGATTT AAGCCGACAC GAGCGATTCG
ATCACAAATC AGCTATACTC TAGACCCAAA TGCAGCGAAA AGAGAAAAAT TCAAATTACA AAAATTTCCG ATGCGTCTAA
AACCTGTGTT AATCCACTTC GTGCAGGAGC CCGTGTACTG CCTGGACGAG CTCCGCTCCA TGCTGGACGG GATGATGCAG
GATTTCGCCT CGTCCGAATT GCCTTCGCCC AGCGGCGGCT TCTTCGCCGG CGCGCCCTCC TCGCCGTTCG CCGACACCGG
CGCCGCGCAG CAGCAGCGCG GGGTCGGCTC CGCCTCCGCG CGCGCGCACG CTCATCCCCA GGTGGTCGGC AACTCTGCCT
GCCTCAGCCG GATGGCCTTC TCCAGCTACT GAGATCAATT TTTGCCAGCG GCCGCAACAT CATCACCTGC ATAGATTAGC
TAGCCTCGTC GACATCGAGT GAGAGTGAGT AGTCGGCGGC GGTGCGGCGC CGCCCCCTGC TGCCGATGAG GCGCGTCAGC
GTCGTGATCT CATGAAGGTG CATGCAGAAA GGTGGCAAGG CAGGGCACTG GAACAAAGTA TTTCTGTTTA TTTTCTTGTC
TTGTTTCGAT GGGATGGGCT CTGCAGCGAG AACTGTCTAT ACTGTTCCGA GTGTACCGTG ACAATGTGAT ATCACGGGAC
TGTTTGCCTT TGTACAGTTT CATGATAAAC AATCTGAAGT AGTAGTAATG AACTAGTGAC AATGATGATG ATGATCGTCG
TTGTTCCGTT CTGTTAGGAT GATGGGACGA TCCCTTTGGT GTG