Os01t0609000-00

Locus

Os01g0609000

Description

Similar to Pleiotropic drug resistance protein 3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PDR10

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 10

Oryzabase Gene Symbol Synonym(s)

OsABCG34, OsPDR10, OsPDR1

Oryzabase Gene Name Synonym(s)

ABC transporter superfamily ABCG subgroup member 34, pleiotropic drug resistance 10, pleiotropic drug resistance 1

Transcript Evidence

AK335724 (DDBJ)

Protein Evidence

Q0JLC5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Functional domain (InterPro)

ABC transporter-like (IPR003439)

ATPase, AAA+ type, core (IPR003593)

ABC-2 type transporter (IPR013525)

Plant PDR ABC transporter associated (IPR013581)

Expression Databases

TENOR (Os01t0609000-00)

Others

Oryzabase (12010)

KEGG (Os01t0609000-00)

Transcript

4505 bp

>Os01t0609000-00 Similar to Pleiotropic drug resistance protein 3.
ATGAGCAGTGCGGGGGTGGTGGAGATGCAGAAGGCGGCGAGCTTCCGGAGGGAGGGCGGG
GGTTCGATGGCGTCCATGTGGCTGAGCGCGGACGGCAACGGCGCGTTCTCGCGGTCGTCG
TCGTCGTCGTCGAGGAGGATGAGAGGGGAGGAGGACGACGAGGAGGCGCTGCGGTGGGCG
GCGCTCCAGAAGCTCCCCACGTACGACCGTGTGCGCGCCGCCATCCTGCCGATGGTGGAG
GGCGAGGGTGGCGAGGCGGGCGGCGGCGGCGGGGGGAGGAGGGTGGTGGTGGACGTGCAC
AGCCTCGGCCCGCACGAGCGGCGCGCGCTGCTCGAACGGCTCGTCCGCGTCGCCGACGAC
GACAACGAGCGCTTCCTGCTCAAGCTCAAGGAGCGCATCAGCCGGGTGGGGATCGACATG
CCGACGATCGAGGTGCGGTTCGAGCACCTGGAGGTGGAGGCGGAGGTCCGCGTCGGCAAC
AGCGGCATCCCCACCGTCCTCAACTCCATCACCAACAAGATCGAGGAGGCCGCCAACGCG
CTGGGCATTCTACCCACTCGGAAGCAGACATTGCGCATCCTCCACGACATCAGTGGCATC
ATCAAGCCCAAAAGGATGACTCTGTTGTTAGGCCCACCCGGATCTGGCAAGACCACATTT
CTACTTGCTTTGGCCGGAAGGCTCAAAGACCTCAAGTTCTCTGGCCAAGTAACTTACAAC
GGACACCAGATGGAGGACTTTGTGCCACAGAGGACTGCTGCGTACATCAGCCAACATGAC
CTTCATATCGGGGAAATGACCGTTCGGGAGACACTCTCATTCTCGGCGCGCTGCCAGGGT
GTTGGAAGCCGCTTTGATATGTTGACCGAGCTGACAAGGCGAGAGAAGGCGGCAAATATC
AAGCCTGATGCTGATGTTGATGCGTTTATGAAGGCTTCAGCAATGGAGGGACAAGAGAGC
AATTTGATTACTGACTATATACTAAAGATATTAGGACTGGAAATATGTGCTGACACGATG
GTAGGAGATGATATGGTGAGGGGTATCTCCGGTGGACAACGGAAGCGTGTCACCACAGGT
GAGATGCTTGTTGGGCCAGCCAATGCATTTTTCATGGATGAGATATCGACTGGGCTCGAT
AGCTCAACTACGTTCCAGATCGTGAAGTCACTCAGGCAGACCATCCACATCCTTGGCGGC
ACAGCAGTCATCTCATTGTTGCAGCCAGCTCCTGAGACATACGACCTATTTGACGACATC
ATACTCCTCTCCGATGGCCATATCGTGTACCAGGGCCCTCGAGAGAATGTGCTCGAATTC
TTTGAGTTGATGGGGTTCAAGTGCCCTGAGAGGAAGGGTGTTGCTGACTTCTTACAGGAA
GTAACTTCCAGGAAAGATCAGAAGCAGTACTGGGCGCAGCATGACAAGCCCTACCGGTAT
GTGCCAATAAAGGAATTTGCTAGCGCATTCCAGTCCTTCCACACTGGGAGAAGTATAGCA
AACGAGCTTGCCACTCCATTCGACAAGAGCAAAAGCCATCCGGCTGCATTGACCACCTCA
AGGTATGGTGTTAGTGCCATGGAACTGCTGAAGGCAAATATCGACCGGGAGTTATTGCTT
ATCAAGAGGAATTCCTTCGTCTATATCTTCAGAACCATCCAGCTGATGACGGTGTCAGCA
ATGGCAATGACTGTCTTCTTTCGTACAAAGATGCACCGTGATTCAGTGGCTGATGGAGTC
ATCTTCATGGGCGCACTCTTTTTTGCAGTGATGATGATAATGCTCAATGGCTTATCTGAG
CTACCGTTAACCATTTTTAAGCTGCCAGTTTTCTTCAAGCAGAGAGACCTCTTATTCTTT
CCAGCATGGACCTACACCATACCCTCATGGATCCTCAAGTCCCCAATGTCCTTTATTGAA
GTTGGTGGGTTTTGTTTCATGTCGTACTATGTGATTGGGTTTGATCCGAATGTAGGCAGG
TTCTTCAAGCAGTATCTGCTTATGTTAGCAGTCAGTCAGATGGCAGCAGCACTCTTCAGA
TTTGTTGGCGGGGCAGCACGGAACCTGATTGTTGCAAATGTCTTTGGATCGTTCATGTTG
CTAATCTTTATGGTTCTGGGTGGTTTTATTCTAGCAAGAGATAAAGTGAATAAATGGTGG
ATTTGGGGCTACTGGATATCTCCGATGATGTATGCACAGAATGCCGTCTCAGTGAATGAG
TTTTTGGGGCACAGCTGGGACAAAGTCTTGAATAATTCTCTCTCCAACGAGACCCTAGGC
GTGCAAGCCCTTATGTCCCGTGGAATCTTCCCTGAAGCCAAGTGGTATTGGATTGGCTTT
GGTGCATTGCTCGGATTCATCATGCTCTTCAATATTCTCTTTACTCTTGCACTAACATAC
CTCAAACCCGATGGTAAGTCCCAACCATCAATATCAGAAGAGGAGCTGAAGGAGAAGCAA
GCAAACATCAATGGTAATGTTCTAGACGTTGATACCATGGCATCAAGTAATAATTTAGCA
ATAGTAGGCAGCACCGGAACTGGTTCAGAAATTGCTGATAATTCTCAACCTACACAAAGG
GGTATGGTTCTCCCCTTTACCCCACTTTCACTCACTTTCGAGGACATCAAATATTCTGTC
GATATGCCACAGGAAATGAAAGCACATGGAATAGTTGAGGACCGGTTGGAACTCCTTAAA
GGTGTCAGTGGGTGTTTCAGGCCAGGAGTGTTGACTGCACTTATGGGTGTTAGTGGTGCT
GGAAAGACTACTCTGATGGATGTGTTAGCAGGGAGAAAAACAGGTGGTTACATTGAAGGC
AACATCTCCATATCAGGATACCCAAAGAAACAAGAGACGTTTGCACGTGTATCAGGATAC
TGTGAACAGAACGACATCCACTCACCTCAAGTGACAGTCTCTGAGTCACTGCTTTTCTCA
GCTTGGCTCCGGCTTCCCAAGGATGTAGATTCAAACACAAGAAAGATGTTCATTGAGGAG
GTGATGGAGCTTGTGGAGCTCAAGCCTTTGAGAGATGCTTTAGTTGGTCTTCCTGGAGTT
AATGGCCTCTCAATTGAGCAGAGGAAGAGACTGACCATTGCCGTAGAGCTTGTTGCTAAT
CCTTCAATCATTTTCATGGATGAGCCAACTTCAGGGCTTGATGCCCGAGCAGCTGCCATT
GTGATGAGGACAGTGAGAAATACTGTCAATACTGGTAGAACTGTGGTATGCACGATTCAT
CAGCCTAGTATTGACATATTTGAAGCATTTGATGAGCTTTTCCTTATGAAGCGAGGAGGA
GAAGAAATATATGTTGGCCCATTAGGCCATCATTCTTCAGAGCTGATTAAGTATTTCGAG
GGGATCCAAGGAGTCAGCAAAATTACAGATGGCTACAATCCAGCCACGTGGATGTTGGAG
GTGACAACAGTTTCTCAAGAACAGGCACTGGATGTTGATTTCTGTGACATATACAGGAAA
TCTGAACTCTTTCAGAGGAACAAGGCATTGATACAGGAACTGAGCACACCACCGCCAGGT
TCAAGTGAACTATATTTTCCTACACAGTACTCACAGTCTTTCTTAATTCAATGCCTGGCA
TGCCTGTGGAAGCAGCACCTGTCATACTGGAGGAATCCTCCTTACAATGCCATAAGACTA
TTTTTCACTACTGTCATAGCTCTCATCTTCGGTACCATCTTCTGGGACCTTGGTGGTAAA
ATGGGCCAGTCACAAGACTTGTTCAACGCCATGGGGTCAATGTATGCTGCAGTGCTGTTT
ATTGGCGTGCTAAACGGTCAGTCAGTTCAGCCAGTGGTATCAGTGGAGAGGACAGTCTTT
TACCGTGAAAGAGCTGCTGGGATGTATTCAGCTCTCCCGTATGCATTTGGGCAGGTTGCC
ATTGAATTCCCGTACACACTTGTTCAGTCTGTCATATATAGCATCATAGTGTACTCGATG
ATTGGGTTCCAATGGACAGTGGCTAAATTCTTCTGGTACCTCTTCTTCATGTTCTTCACG
CTGCTATACTTCACATTCTACGGCATGATGGCTGTGGGCCTAACACCAAGCTACCATGTC
GCCTCAATCGTCTCCTCGGCTTTCTATGCCATCTGGAACCTCTTCACCGGGTTCGTCATC
TCCAGACCGGCAACTCCAGTCTGGTGGAGATGGTACTGCTGGATATGCCCTGTAGCATGG
ACACTATACGGGCTGATTGTCTCGCAATATGGAGATATCGTGACGCCGATGGATGATGGC
ATACCCGTGAATGTCTTCGTGGAGAACTATTTTGACTTTAAGCACAGCTGGCTGGGTTTC
GTGGCTGTGGTGATCGTCGCATTCACCATGTTATTTGCCTTCCTGTTTGGCTTTGCCATC
ATGAAGCTCAACTTCCAGAAGAGATAGTGATTGATAGGGACTAGGAAACAGGTCCTAAAC
TAGGAATTAGATCGATTGATTTGCATATACGAATTAATTTGTGCATATCGGTGTAGAACA
TGAAA

CDS

4407 bp

>Os01t0609000-00 Similar to Pleiotropic drug resistance protein 3.
ATGAGCAGTGCGGGGGTGGTGGAGATGCAGAAGGCGGCGAGCTTCCGGAGGGAGGGCGGG
GGTTCGATGGCGTCCATGTGGCTGAGCGCGGACGGCAACGGCGCGTTCTCGCGGTCGTCG
TCGTCGTCGTCGAGGAGGATGAGAGGGGAGGAGGACGACGAGGAGGCGCTGCGGTGGGCG
GCGCTCCAGAAGCTCCCCACGTACGACCGTGTGCGCGCCGCCATCCTGCCGATGGTGGAG
GGCGAGGGTGGCGAGGCGGGCGGCGGCGGCGGGGGGAGGAGGGTGGTGGTGGACGTGCAC
AGCCTCGGCCCGCACGAGCGGCGCGCGCTGCTCGAACGGCTCGTCCGCGTCGCCGACGAC
GACAACGAGCGCTTCCTGCTCAAGCTCAAGGAGCGCATCAGCCGGGTGGGGATCGACATG
CCGACGATCGAGGTGCGGTTCGAGCACCTGGAGGTGGAGGCGGAGGTCCGCGTCGGCAAC
AGCGGCATCCCCACCGTCCTCAACTCCATCACCAACAAGATCGAGGAGGCCGCCAACGCG
CTGGGCATTCTACCCACTCGGAAGCAGACATTGCGCATCCTCCACGACATCAGTGGCATC
ATCAAGCCCAAAAGGATGACTCTGTTGTTAGGCCCACCCGGATCTGGCAAGACCACATTT
CTACTTGCTTTGGCCGGAAGGCTCAAAGACCTCAAGTTCTCTGGCCAAGTAACTTACAAC
GGACACCAGATGGAGGACTTTGTGCCACAGAGGACTGCTGCGTACATCAGCCAACATGAC
CTTCATATCGGGGAAATGACCGTTCGGGAGACACTCTCATTCTCGGCGCGCTGCCAGGGT
GTTGGAAGCCGCTTTGATATGTTGACCGAGCTGACAAGGCGAGAGAAGGCGGCAAATATC
AAGCCTGATGCTGATGTTGATGCGTTTATGAAGGCTTCAGCAATGGAGGGACAAGAGAGC
AATTTGATTACTGACTATATACTAAAGATATTAGGACTGGAAATATGTGCTGACACGATG
GTAGGAGATGATATGGTGAGGGGTATCTCCGGTGGACAACGGAAGCGTGTCACCACAGGT
GAGATGCTTGTTGGGCCAGCCAATGCATTTTTCATGGATGAGATATCGACTGGGCTCGAT
AGCTCAACTACGTTCCAGATCGTGAAGTCACTCAGGCAGACCATCCACATCCTTGGCGGC
ACAGCAGTCATCTCATTGTTGCAGCCAGCTCCTGAGACATACGACCTATTTGACGACATC
ATACTCCTCTCCGATGGCCATATCGTGTACCAGGGCCCTCGAGAGAATGTGCTCGAATTC
TTTGAGTTGATGGGGTTCAAGTGCCCTGAGAGGAAGGGTGTTGCTGACTTCTTACAGGAA
GTAACTTCCAGGAAAGATCAGAAGCAGTACTGGGCGCAGCATGACAAGCCCTACCGGTAT
GTGCCAATAAAGGAATTTGCTAGCGCATTCCAGTCCTTCCACACTGGGAGAAGTATAGCA
AACGAGCTTGCCACTCCATTCGACAAGAGCAAAAGCCATCCGGCTGCATTGACCACCTCA
AGGTATGGTGTTAGTGCCATGGAACTGCTGAAGGCAAATATCGACCGGGAGTTATTGCTT
ATCAAGAGGAATTCCTTCGTCTATATCTTCAGAACCATCCAGCTGATGACGGTGTCAGCA
ATGGCAATGACTGTCTTCTTTCGTACAAAGATGCACCGTGATTCAGTGGCTGATGGAGTC
ATCTTCATGGGCGCACTCTTTTTTGCAGTGATGATGATAATGCTCAATGGCTTATCTGAG
CTACCGTTAACCATTTTTAAGCTGCCAGTTTTCTTCAAGCAGAGAGACCTCTTATTCTTT
CCAGCATGGACCTACACCATACCCTCATGGATCCTCAAGTCCCCAATGTCCTTTATTGAA
GTTGGTGGGTTTTGTTTCATGTCGTACTATGTGATTGGGTTTGATCCGAATGTAGGCAGG
TTCTTCAAGCAGTATCTGCTTATGTTAGCAGTCAGTCAGATGGCAGCAGCACTCTTCAGA
TTTGTTGGCGGGGCAGCACGGAACCTGATTGTTGCAAATGTCTTTGGATCGTTCATGTTG
CTAATCTTTATGGTTCTGGGTGGTTTTATTCTAGCAAGAGATAAAGTGAATAAATGGTGG
ATTTGGGGCTACTGGATATCTCCGATGATGTATGCACAGAATGCCGTCTCAGTGAATGAG
TTTTTGGGGCACAGCTGGGACAAAGTCTTGAATAATTCTCTCTCCAACGAGACCCTAGGC
GTGCAAGCCCTTATGTCCCGTGGAATCTTCCCTGAAGCCAAGTGGTATTGGATTGGCTTT
GGTGCATTGCTCGGATTCATCATGCTCTTCAATATTCTCTTTACTCTTGCACTAACATAC
CTCAAACCCGATGGTAAGTCCCAACCATCAATATCAGAAGAGGAGCTGAAGGAGAAGCAA
GCAAACATCAATGGTAATGTTCTAGACGTTGATACCATGGCATCAAGTAATAATTTAGCA
ATAGTAGGCAGCACCGGAACTGGTTCAGAAATTGCTGATAATTCTCAACCTACACAAAGG
GGTATGGTTCTCCCCTTTACCCCACTTTCACTCACTTTCGAGGACATCAAATATTCTGTC
GATATGCCACAGGAAATGAAAGCACATGGAATAGTTGAGGACCGGTTGGAACTCCTTAAA
GGTGTCAGTGGGTGTTTCAGGCCAGGAGTGTTGACTGCACTTATGGGTGTTAGTGGTGCT
GGAAAGACTACTCTGATGGATGTGTTAGCAGGGAGAAAAACAGGTGGTTACATTGAAGGC
AACATCTCCATATCAGGATACCCAAAGAAACAAGAGACGTTTGCACGTGTATCAGGATAC
TGTGAACAGAACGACATCCACTCACCTCAAGTGACAGTCTCTGAGTCACTGCTTTTCTCA
GCTTGGCTCCGGCTTCCCAAGGATGTAGATTCAAACACAAGAAAGATGTTCATTGAGGAG
GTGATGGAGCTTGTGGAGCTCAAGCCTTTGAGAGATGCTTTAGTTGGTCTTCCTGGAGTT
AATGGCCTCTCAATTGAGCAGAGGAAGAGACTGACCATTGCCGTAGAGCTTGTTGCTAAT
CCTTCAATCATTTTCATGGATGAGCCAACTTCAGGGCTTGATGCCCGAGCAGCTGCCATT
GTGATGAGGACAGTGAGAAATACTGTCAATACTGGTAGAACTGTGGTATGCACGATTCAT
CAGCCTAGTATTGACATATTTGAAGCATTTGATGAGCTTTTCCTTATGAAGCGAGGAGGA
GAAGAAATATATGTTGGCCCATTAGGCCATCATTCTTCAGAGCTGATTAAGTATTTCGAG
GGGATCCAAGGAGTCAGCAAAATTACAGATGGCTACAATCCAGCCACGTGGATGTTGGAG
GTGACAACAGTTTCTCAAGAACAGGCACTGGATGTTGATTTCTGTGACATATACAGGAAA
TCTGAACTCTTTCAGAGGAACAAGGCATTGATACAGGAACTGAGCACACCACCGCCAGGT
TCAAGTGAACTATATTTTCCTACACAGTACTCACAGTCTTTCTTAATTCAATGCCTGGCA
TGCCTGTGGAAGCAGCACCTGTCATACTGGAGGAATCCTCCTTACAATGCCATAAGACTA
TTTTTCACTACTGTCATAGCTCTCATCTTCGGTACCATCTTCTGGGACCTTGGTGGTAAA
ATGGGCCAGTCACAAGACTTGTTCAACGCCATGGGGTCAATGTATGCTGCAGTGCTGTTT
ATTGGCGTGCTAAACGGTCAGTCAGTTCAGCCAGTGGTATCAGTGGAGAGGACAGTCTTT
TACCGTGAAAGAGCTGCTGGGATGTATTCAGCTCTCCCGTATGCATTTGGGCAGGTTGCC
ATTGAATTCCCGTACACACTTGTTCAGTCTGTCATATATAGCATCATAGTGTACTCGATG
ATTGGGTTCCAATGGACAGTGGCTAAATTCTTCTGGTACCTCTTCTTCATGTTCTTCACG
CTGCTATACTTCACATTCTACGGCATGATGGCTGTGGGCCTAACACCAAGCTACCATGTC
GCCTCAATCGTCTCCTCGGCTTTCTATGCCATCTGGAACCTCTTCACCGGGTTCGTCATC
TCCAGACCGGCAACTCCAGTCTGGTGGAGATGGTACTGCTGGATATGCCCTGTAGCATGG
ACACTATACGGGCTGATTGTCTCGCAATATGGAGATATCGTGACGCCGATGGATGATGGC
ATACCCGTGAATGTCTTCGTGGAGAACTATTTTGACTTTAAGCACAGCTGGCTGGGTTTC
GTGGCTGTGGTGATCGTCGCATTCACCATGTTATTTGCCTTCCTGTTTGGCTTTGCCATC
ATGAAGCTCAACTTCCAGAAGAGATAG

Protein

1468 aa

>Os01t0609000-00 Similar to Pleiotropic drug resistance protein 3.
MSSAGVVEMQKAASFRREGGGSMASMWLSADGNGAFSRSSSSSSRRMRGEEDDEEALRWA
ALQKLPTYDRVRAAILPMVEGEGGEAGGGGGGRRVVVDVHSLGPHERRALLERLVRVADD
DNERFLLKLKERISRVGIDMPTIEVRFEHLEVEAEVRVGNSGIPTVLNSITNKIEEAANA
LGILPTRKQTLRILHDISGIIKPKRMTLLLGPPGSGKTTFLLALAGRLKDLKFSGQVTYN
GHQMEDFVPQRTAAYISQHDLHIGEMTVRETLSFSARCQGVGSRFDMLTELTRREKAANI
KPDADVDAFMKASAMEGQESNLITDYILKILGLEICADTMVGDDMVRGISGGQRKRVTTG
EMLVGPANAFFMDEISTGLDSSTTFQIVKSLRQTIHILGGTAVISLLQPAPETYDLFDDI
ILLSDGHIVYQGPRENVLEFFELMGFKCPERKGVADFLQEVTSRKDQKQYWAQHDKPYRY
VPIKEFASAFQSFHTGRSIANELATPFDKSKSHPAALTTSRYGVSAMELLKANIDRELLL
IKRNSFVYIFRTIQLMTVSAMAMTVFFRTKMHRDSVADGVIFMGALFFAVMMIMLNGLSE
LPLTIFKLPVFFKQRDLLFFPAWTYTIPSWILKSPMSFIEVGGFCFMSYYVIGFDPNVGR
FFKQYLLMLAVSQMAAALFRFVGGAARNLIVANVFGSFMLLIFMVLGGFILARDKVNKWW
IWGYWISPMMYAQNAVSVNEFLGHSWDKVLNNSLSNETLGVQALMSRGIFPEAKWYWIGF
GALLGFIMLFNILFTLALTYLKPDGKSQPSISEEELKEKQANINGNVLDVDTMASSNNLA
IVGSTGTGSEIADNSQPTQRGMVLPFTPLSLTFEDIKYSVDMPQEMKAHGIVEDRLELLK
GVSGCFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGNISISGYPKKQETFARVSGY
CEQNDIHSPQVTVSESLLFSAWLRLPKDVDSNTRKMFIEEVMELVELKPLRDALVGLPGV
NGLSIEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVNTGRTVVCTIH
QPSIDIFEAFDELFLMKRGGEEIYVGPLGHHSSELIKYFEGIQGVSKITDGYNPATWMLE
VTTVSQEQALDVDFCDIYRKSELFQRNKALIQELSTPPPGSSELYFPTQYSQSFLIQCLA
CLWKQHLSYWRNPPYNAIRLFFTTVIALIFGTIFWDLGGKMGQSQDLFNAMGSMYAAVLF
IGVLNGQSVQPVVSVERTVFYRERAAGMYSALPYAFGQVAIEFPYTLVQSVIYSIIVYSM
IGFQWTVAKFFWYLFFMFFTLLYFTFYGMMAVGLTPSYHVASIVSSAFYAIWNLFTGFVI
SRPATPVWWRWYCWICPVAWTLYGLIVSQYGDIVTPMDDGIPVNVFVENYFDFKHSWLGF
VAVVIVAFTMLFAFLFGFAIMKLNFQKR*

CDS

chr01:24055515..24055918 (- strand) : 404 bp

chr01:24055220..24055429 (- strand) : 210 bp

chr01:24054954..24055035 (- strand) : 82 bp

chr01:24054081..24054240 (- strand) : 160 bp

chr01:24053917..24053993 (- strand) : 77 bp

chr01:24053770..24053823 (- strand) : 54 bp

chr01:24053588..24053678 (- strand) : 91 bp

chr01:24053214..24053515 (- strand) : 302 bp

chr01:24052855..24053136 (- strand) : 282 bp

chr01:24052445..24052761 (- strand) : 317 bp

chr01:24052194..24052354 (- strand) : 161 bp

chr01:24051365..24051631 (- strand) : 267 bp

chr01:24050891..24051135 (- strand) : 245 bp

chr01:24050460..24050792 (- strand) : 333 bp

chr01:24050091..24050381 (- strand) : 291 bp

chr01:24049797..24049880 (- strand) : 84 bp

chr01:24049577..24049710 (- strand) : 134 bp

chr01:24048506..24048733 (- strand) : 228 bp

chr01:24048248..24048419 (- strand) : 172 bp

chr01:24047892..24048146 (- strand) : 255 bp

chr01:24047544..24047801 (- strand) : 258 bp

3'UTR

chr01:24047446..24047543 (- strand) : 98 bp

FASTA

>Os01t0609000-00 class=Sequence position=chr01:24047446..24055918 (- strand)
ATGAGCAGTG CGGGGGTGGT GGAGATGCAG AAGGCGGCGA GCTTCCGGAG GGAGGGCGGG GGTTCGATGG CGTCCATGTG
GCTGAGCGCG GACGGCAACG GCGCGTTCTC GCGGTCGTCG TCGTCGTCGT CGAGGAGGAT GAGAGGGGAG GAGGACGACG
AGGAGGCGCT GCGGTGGGCG GCGCTCCAGA AGCTCCCCAC GTACGACCGT GTGCGCGCCG CCATCCTGCC GATGGTGGAG
GGCGAGGGTG GCGAGGCGGG CGGCGGCGGC GGGGGGAGGA GGGTGGTGGT GGACGTGCAC AGCCTCGGCC CGCACGAGCG
GCGCGCGCTG CTCGAACGGC TCGTCCGCGT CGCCGACGAC GACAACGAGC GCTTCCTGCT CAAGCTCAAG GAGCGCATCA
GCCGGTGGGC TATAGCTTTT GTCTGCTGGG TGTTTGATGA TTTGCGCGCG TGGCTGGCTG ATATTGGGGT TGTGCGCTTG
GATGTGCAGG GTGGGGATCG ACATGCCGAC GATCGAGGTG CGGTTCGAGC ACCTGGAGGT GGAGGCGGAG GTCCGCGTCG
GCAACAGCGG CATCCCCACC GTCCTCAACT CCATCACCAA CAAGATCGAG GAGGCCGCCA ACGCGCTGGG CATTCTACCC
ACTCGGAAGC AGACATTGCG CATCCTCCAC GACATCAGTG GCATCATCAA GCCCAAAAGG TGAAAAGAAA AAAAACAAGC
ATCGTGTTTT CGCTTCTGCT TCATATATAC AACGTTTATT GGGGAAATTT TGAAGCATTG TAACGGAGTT TAGTATAGAT
TAATTGTTAA CCAAGATATT TTGGAATTCA ACTTTTGTGT TTCTCCTACA TCAGTACAAC ATCGCGTTCC TTTGTTTGTA
CAGGATGACT CTGTTGTTAG GCCCACCCGG ATCTGGCAAG ACCACATTTC TACTTGCTTT GGCCGGAAGG CTCAAAGACC
TCAAGGTTTG CAATAATCTT TCTTCACTTG TTTTGCAGTA ACTGCAATGT AATGAGGCCT TTAGCTTTAG CAAACCAGTC
TCCACTTCAT CTTTAATGTA GTATATAGTT CGCCAAAAAA CAGAGAGCTT TGTTTGGGGA ATGCGTAAAA GGCCCAGGCA
TTATTGCATT AAGATAGtgg gtaattttat aatccttgaa aatgtatcta gaggtaccat attttctagt ataaaatttg
atatctttag atactaagGC TGCGTTCAGA ACTGCTAGTT CCCAACCCCT ATCTCTCGtt tttcgcgcgc acgcctttta
aactgttaaa cgatgtgttt ttttgcaaaa agtttttata cgaaaattgc ttaaaaaatc aaattaatcc attttcaaaa
aaaaattagc taatacttaa ttaatcatgt gttaatggac tgctccgttt tctatgcggg gagatgggtt cctaaccccc
aagtaatgaa cataGCctaa gtatctcgag gcaccaaaaa ttttagtgta aaatttaggt acctcaaagt actttttcaa
ggactgtaaa attcctcTAA GATACTAGAA ACAAAGTTCT CGCGAACAGA GAACTTATCT TAGGGGACAT GTCCCAAAAG
AATGTAAACC TCGCTGTAGA GTGACATTAC TGATTACCAA CATACACAAT TTATACTGGG AGTAAAAATA TCGTGCAGTT
CTCTGGCCAA GTAACTTACA ACGGACACCA GATGGAGGAC TTTGTGCCAC AGAGGACTGC TGCGTACATC AGCCAACATG
ACCTTCATAT CGGGGAAATG ACCGTTCGGG AGACACTCTC ATTCTCGGCG CGCTGCCAGG GTGTTGGAAG CCGCTTTGGT
ATACATTCTT TTCTGCAGAA TTTGCCTTTC CTGATCGTCA AGGGTTGATT GATATGCTTA TCAAGTTCAA TTGTTATGTC
AATAGATATG TTGACCGAGC TGACAAGGCG AGAGAAGGCG GCAAATATCA AGCCTGATGC TGATGTTGAT GCGTTTATGA
AGGTGAAAAT TTGCAAATCC TATATAGAAT AAGAATTACT CTGGTGTAAA TTTGAGTGAG GAATTGCTAT AAATTTTTTG
TCTTAACTTC ATCAGGCTTC AGCAATGGAG GGACAAGAGA GCAATTTGAT TACTGACTAT ATACTAAAGG TGCATGCATC
TCTGAGCTAC AATAGCTAGT GATTTCAATT TGGATTAAGC GAAATCGTCT TGTTTAATAT TTACATGTTA CTTAATGCAG
ATATTAGGAC TGGAAATATG TGCTGACACG ATGGTAGGAG ATGATATGGT GAGGGGTATC TCCGGTGGAC AACGGAAGCG
TGTCACCACA GGTAAAAAGA TAGAATTTCA CTTTCAGAAC ATGGGATTTG CTGGACAATG TTTTGATTGA CTGTTTCTTC
CAGGTGAGAT GCTTGTTGGG CCAGCCAATG CATTTTTCAT GGATGAGATA TCGACTGGGC TCGATAGCTC AACTACGTTC
CAGATCGTGA AGTCACTCAG GCAGACCATC CACATCCTTG GCGGCACAGC AGTCATCTCA TTGTTGCAGC CAGCTCCTGA
GACATACGAC CTATTTGACG ACATCATACT CCTCTCCGAT GGCCATATCG TGTACCAGGG CCCTCGAGAG AATGTGCTCG
AATTCTTTGA GTTGATGGGG TTCAAGTGCC CTGAGAGGAA GGGTGTTGCT GACTTCTTAC AGGAAGTGAG TGATTCTACA
ATGTTCAAAA ATATATATGC ACAAATTTGT TAGTTATATA TCTATATGGA AATTTTGAGC AGGTAACTTC CAGGAAAGAT
CAGAAGCAGT ACTGGGCGCA GCATGACAAG CCCTACCGGT ATGTGCCAAT AAAGGAATTT GCTAGCGCAT TCCAGTCCTT
CCACACTGGG AGAAGTATAG CAAACGAGCT TGCCACTCCA TTCGACAAGA GCAAAAGCCA TCCGGCTGCA TTGACCACCT
CAAGGTATGG TGTTAGTGCC ATGGAACTGC TGAAGGCAAA TATCGACCGG GAGTTATTGC TTATCAAGAG GAATTCCTTC
GTCTATATCT TCAGAACCAT CCAGGTTGTT AGAGATTCAT TCAAACAAAT CGAGTAATTG GTATATGTGG CAAACCAACG
ACGTCATGAC TGACTTCTTG CGTAATTCGT ATGGCAGCTG ATGACGGTGT CAGCAATGGC AATGACTGTC TTCTTTCGTA
CAAAGATGCA CCGTGATTCA GTGGCTGATG GAGTCATCTT CATGGGCGCA CTCTTTTTTG CAGTGATGAT GATAATGCTC
AATGGCTTAT CTGAGCTACC GTTAACCATT TTTAAGCTGC CAGTTTTCTT CAAGCAGAGA GACCTCTTAT TCTTTCCAGC
ATGGACCTAC ACCATACCCT CATGGATCCT CAAGTCCCCA ATGTCCTTTA TTGAAGTTGG TGGGTTTTGT TTCATGTCGT
ACTATGTGAT TGGGTTTGAT CCGAATGTAG GCAGGTGAGA TTTTTGGAGA AAACCATTGG TCACTGTATC TTATCGAACT
TCATTCACTA GCTATTCTTT ACTCGTGAAT TGTTGTGGCG TTAGGTTCTT CAAGCAGTAT CTGCTTATGT TAGCAGTCAG
TCAGATGGCA GCAGCACTCT TCAGATTTGT TGGCGGGGCA GCACGGAACC TGATTGTTGC AAATGTCTTT GGATCGTTCA
TGTTGCTAAT CTTTATGGTT CTGGGTGGTT TTATTCTAGC AAGAGGTAAA ACTTCATCTC TGTACTATGT AGTTATTTTC
ATTGTTGCAC TTTTTTTAGT AAGGCAAGTT CTtatcctat atacttatat agttcatccc cactaagtgt agttaatgtt
atttctctct tctctcatta agccacatca acccaattat ttctagccat tgaatgatag atatatggtt caaattgtct
cttctttctt ctctaataac accaagtaat ctcaattttt tttaGGCCTC AGAATTCATA AGTATCAATT TGTTTTAGTT
TTAATACTCA TATTTCATCT TATGTGTATA TATTGTGCAA CTTAATTTTC TGTAGCAACG CGACAATTAT TTTTAGCCAT
TGGATAATAG ATCTATGGTT CAAATTGTCT CTTCTTTCTT CTCTAATAAC ACCAAGTAAT CTCAATTTTT TTAGGCCTCA
AAATTCATAA GTATCAATTT GTTTTAGTTT TAATATTTAT ATTTCATCTT ATTTGTACAT ATTGTGCAAC TTAATTTCCC
GCAGCAACGT GACGGGGTAT TTATCTTGTT TATGAATGTA CTCGCAGATA AAGTGAATAA ATGGTGGATT TGGGGCTACT
GGATATCTCC GATGATGTAT GCACAGAATG CCGTCTCAGT GAATGAGTTT TTGGGGCACA GCTGGGACAA AGTCTTGAAT
AATTCTCTCT CCAACGAGAC CCTAGGCGTG CAAGCCCTTA TGTCCCGTGG AATCTTCCCT GAAGCCAAGT GGTATTGGAT
TGGCTTTGGT GCATTGCTCG GATTCATCAT GCTCTTCAAT ATTCTCTTTA CTCTTGCACT AACATACCTC AAACGTGAGT
TCCTTCCGAA TTGGTTTGCT ATTTTTCTTT CTTTTTTTTT TGATATAAAG CATGGCAGTT CTGCCTCATT TCAAGCAAAT
AGATAGAAGA TAATGCAAAC ACCAACCCAA AATCCGTAGA CTAAACACTA AGATAACAAC ACAGTGACAC AGAAGCACCT
CAAAATCATC AAGCTTGCTC ATCGTTCTTA CCTTAGAATG GTTTTCATCT TCTGATTATA CAGCCGATGG TAAGTCCCAA
CCATCAATAT CAGAAGAGGA GCTGAAGGAG AAGCAAGCAA ACATCAATGG TAATGTTCTA GACGTTGATA CCATGGCATC
AAGTAATAAT TTAGCAATAG TAGGCAGCAC CGGAACTGGT TCAGAAATTG CTGATAATTC TCAACCTACA CAAAGGGGTA
TGGTTCTCCC CTTTACCCCA CTTTCACTCA CTTTCGAGGA CATCAAATAT TCTGTCGATA TGCCACAGGT AAGTTATTTC
AATTTTTTAA CTTACAATGT CCACCAGTGA GTCAATGATG ATTAATTTAT CTTGACCCTC TGTATTAAAT TAAAATTCAA
ATTCAGGAAA TGAAAGCACA TGGAATAGTT GAGGACCGGT TGGAACTCCT TAAAGGTGTC AGTGGGTGTT TCAGGCCAGG
AGTGTTGACT GCACTTATGG GTGTTAGTGG TGCTGGAAAG ACTACTCTGA TGGATGTGTT AGCAGGGAGA AAAACAGGTG
GTTACATTGA AGGCAACATC TCCATATCAG GATACCCAAA GAAACAAGAG ACGTTTGCAC GTGTATCAGG ATACTGTGAA
CAGAACGACA TCCACTCACC TCAAGTGACA GTCTCTGAGT CACTGCTTTT CTCAGCTTGG CTCCGGCTTC CCAAGGATGT
AGATTCAAAC ACAAGAAAGG TCAGTCAAGC AAAATGGTTG TAATTCATTC TCAGCTGATA CTCAATGGAT AAAATTCCTT
AACCTTTATC TATGCAGATG TTCATTGAGG AGGTGATGGA GCTTGTGGAG CTCAAGCCTT TGAGAGATGC TTTAGTTGGT
CTTCCTGGAG TTAATGGCCT CTCAATTGAG CAGAGGAAGA GACTGACCAT TGCCGTAGAG CTTGTTGCTA ATCCTTCAAT
CATTTTCATG GATGAGCCAA CTTCAGGGCT TGATGCCCGA GCAGCTGCCA TTGTGATGAG GACAGTGAGA AATACTGTCA
ATACTGGTAG AACTGTGGTA TGCACGATTC ATCAGCCTAG TATTGACATA TTTGAAGCAT TTGATGAGGT GAGCATACGT
TGGAATATTT GCTACTTGCT TCGTtatctt aaatatgaca ccattgactt ttgatgtgat gttagactat tcgtcctatt
caaaaaaata tataaatgtg acgtttgatg tgatgtaacg ttttatgtga ataatgttct atggtcctaa atctttttag
atAAATGTAC ATGGTCCTAA ATGTTTTATT ATTTGCAGCT TTTCCTTATG AAGCGAGGAG GAGAAGAAAT ATATGTTGGC
CCATTAGGCC ATCATTCTTC AGAGCTGATT AAGTATTTCG AGGTATACTA ATATTACACA AGTTTCAATA TACCTCCGTT
TGGTTTGTTC AAGACTGTGC TAATCTTATA TTGTTTCGTG TTCTCAAGGG GATCCAAGGA GTCAGCAAAA TTACAGATGG
CTACAATCCA GCCACGTGGA TGTTGGAGGT GACAACAGTT TCTCAAGAAC AGGCACTGGA TGTTGATTTC TGTGACATAT
ACAGGAAATC TGAACTCTTT CAGTAAGTAA ATTACTTTTA TGTTAAATCC AGTAAATCAA ATACTTGACT CATTTGCAAT
CCCAGTAGTC AAAACTACAA TCTCCTTATG TTTTTTATGC CTTTATGGTG GTGACAAACC AACAAGAGTA AATAAGTAGG
CTTCAATACA GTTGGTCAAA TTTACATGCC TTCTACAGAT AATGCATCAT ACTACTGCAA GTATGCTACT AACAATTTAG
CTTGTGATAA AATGCAAGAC AATCGGTTTA CTCATGCTGT TACATTTTGC AGTAGTATTG AACTTTCTTT TTCTCCAAAG
AAGTTTTGTT GTGCCTAGTT TTGTTATAGA ATGTTAGCAC TATTGTCAAG GTTTGATTTC AGAATACTAT GCTATATAGC
AAATGGACAA GAGCTAGAGT GGTTCCACTA CCACTGCAGC TCTACGACAG AGGAATTGGT GTGCTCCACA TGTCAAATTC
ACATTAATAA CTGCAAACTG TTGTGTGACT TGAGTCGCTT TCACATTTTT TTATGTTCAT GTATTTGAAA TTTCAAAATA
ATTTAATTTA TATGATAGTA TGAAATTAAG TCTTTACTTC TACTGGGATA ATGATTAACT TTTAAGATAA TCTTATCATC
AATTAGATTA ACATGTGAAG TGACTAGGTA CACATGTTTG CCTTTTATGC ACTTCATGTA CACTTCTCTG AAGTGGGAAC
TAGGAAGATT TAGGACATTA GGTTCTGAAA GCATTTTAAC TAAGAAGTGT CATTTCAACA TTTTCCATAG CATCTGTCAG
ATTATTCAAT TCAATATTAT ACAACTCATA ATTGCAATCT GAACATTGGC AATTGATATT CATAGGAGGA ACAAGGCATT
GATACAGGAA CTGAGCACAC CACCGCCAGG TTCAAGTGAA CTATATTTTC CTACACAGTA CTCACAGTCT TTCTTAATTC
AATGCCTGGC ATGCCTGTGG AAGCAGCACC TGTCATACTG GAGGAATCCT CCTTACAATG CCATAAGACT ATTTTTCACT
ACTGTCATAG CTCTCATCTT CGGTACCATC TTCTGGGACC TTGGTGGTAA AATGTATGCA CTTACCATGT AGACATATAT
GGCGTATGAC TAAACCATCT TCAAAATGTA ATTTACGCGT CTTTGGCTTC TTGATCCAGG GGCCAGTCAC AAGACTTGTT
CAACGCCATG GGGTCAATGT ATGCTGCAGT GCTGTTTATT GGCGTGCTAA ACGGTCAGTC AGTTCAGCCA GTGGTATCAG
TGGAGAGGAC AGTCTTTTAC CGTGAAAGAG CTGCTGGGAT GTATTCAGCT CTCCCGTATG CATTTGGGCA GGTACATAGC
TCTCATATCA ATTCGACAAT GCCTGACACT GCTTTGCCTG CTGGTTATCG TATTGCTGAG AAACCTGACA GTTATCAACT
TCTCCCTTGC AGGTTGCCAT TGAATTCCCG TACACACTTG TTCAGTCTGT CATATATAGC ATCATAGTGT ACTCGATGAT
TGGGTTCCAA TGGACAGTGG CTAAATTCTT CTGGTACCTC TTCTTCATGT TCTTCACGCT GCTATACTTC ACATTCTACG
GCATGATGGC TGTGGGCCTA ACACCAAGCT ACCATGTCGC CTCAATCGTC TCCTCGGCTT TCTATGCCAT CTGGAACCTC
TTCACCGGGT TCGTCATCTC CAGACCGGTA ACCACCACCA TCCTTATGGC CCCTGCATTT AATTTTGTTT CATCATTTCT
ATAGCTCAAT TCCATTTTCC CTGGACCGTG TGCTCAGGCA ACTCCAGTCT GGTGGAGATG GTACTGCTGG ATATGCCCTG
TAGCATGGAC ACTATACGGG CTGATTGTCT CGCAATATGG AGATATCGTG ACGCCGATGG ATGATGGCAT ACCCGTGAAT
GTCTTCGTGG AGAACTATTT TGACTTTAAG CACAGCTGGC TGGGTTTCGT GGCTGTGGTG ATCGTCGCAT TCACCATGTT
ATTTGCCTTC CTGTTTGGCT TTGCCATCAT GAAGCTCAAC TTCCAGAAGA GATAGTGATT GATAGGGACT AGGAAACAGG
TCCTAAACTA GGAATTAGAT CGATTGATTT GCATATACGA ATTAATTTGT GCATATCGGT GTAGAACATG AAA

Locus: Os01g0609000

Loading...

Locus: Os01g0609000

Loading...