Os01t0609200-00

Locus

Os01g0609200

Description

Similar to Pleiotropic drug resistance protein 3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PDR11

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 11

Oryzabase Gene Symbol Synonym(s)

OsABCG35, OsPDR11, OsPDR2

Oryzabase Gene Name Synonym(s)

ABC transporter superfamily ABCG subgroup member 35, pleiotropic drug resistance 11, pleiotropic drug resistance 2

Transcript Evidence

Q8GU92 (UniProt)

Protein Evidence

Q8GU92 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Functional domain (InterPro)

ABC transporter-like (IPR003439)

ATPase, AAA+ type, core (IPR003593)

ABC-2 type transporter (IPR013525)

Plant PDR ABC transporter associated (IPR013581)

Expression Databases

TENOR (Os01t0609200-00)

Others

Oryzabase (12011)

Transcript

4395 bp

>Os01t0609200-00 Similar to Pleiotropic drug resistance protein 3.
ATGGATGCGGCGGCGGAGATGCAGAAGGTGGTGAGCCTGAGGAGAGGGGGAGGGGGGTCG
TCGTCGCGGGGGGCGGCGTCGATGTGGTGGAGCGCGGACAACGGGGTGTTCTCGCGGTCG
AGGGCGTCGTCGAGTGGGGAGGATGGGGAGGACGACGAGGAGGCGCTGCGGTGGGCGGCG
CTCGAGAAGCTGCCCACGTACGACCGCGTGCGCCGCGCCGTACTGCCGGTGGTGGAGGAG
GGCGGCGGCGGAGGGGAGGCGGGGAAGAAGGTGGTGGACGTGCTCAGCCTCGGCCCGCAG
GAGCGGCGGGCGCTGCTCGAGCGGCTCGTGCGCGTCGCCGAGGACGACAACGAGCGCTTC
CTTCTCAAGCTCAAGGAGCGCATCGACCGGGTGGGGATTGATATTCCGACGATCGAGGTG
CGGTTCGAGCACCTGGAGGCGGAGGCGGAGGTCCGCGTCGGCAACAGCGGCCTCCCCACC
GTCCTCAACTCCATGACCAACAAGCTCGAGGGAGCCGCGAACGCGCTGGGGATTCTACCC
AACAAGAAGCAGACCATGCCCATCCTCCACGACGTCAGCGGCATCGTCAAGCCCCGCAGG
ATGACTCTGCTGTTAGGACCTCCCGGGTCTGGCAAGACCACCTTGCTACTTGCTTTGGCT
GGAAGGCTTGGCAAAGACATCAAGTTCTCTGGTCAAGTGACTTACAATGGACACCAGATG
GAGGATTTTGTGCCACAGAGGACAGCTGCATACATCAGCCAGCATGATCTTCATATTGGG
GAAATGACTGTTCGGGAGACACTCTCATTCTCGGCACGCTGCCAGGGTGTTGGAAGCCGC
TTTGATATGCTGACCGAGCTGTCAAGGCGAGAGAAGGCAGCAAATATTAAGCCTGATGCT
GATATTGATGCGTTTATGAAGGCTTCAGCGATGGAGGGACAAGAGACCAATTTGATTACT
GACTATATACTGAAGATATTAGGACTGGATATATGTGCAGACACGATGGTAGGAGATGAT
ATGGTGAGGGGTATCTCCGGTGGACAACGGAAGCGTGTCACCACAGGTGAGATGCTTGTT
GGGCCAGCCAATGCACTTTTCATGGATGAGATATCGACTGGGCTCGACAGCTCAACTACA
TTTCAGATCGTGAAGTCGCTCAGACAGGCCATCCACATCCTCGGTGGCACAGCAGTCATC
TCGCTGTTGCAGCCAGCTCCAGAGACATATGACCTATTTGACGACATCATACTCCTCTCT
GATGGTCAGATTGTATACCAGGGGCCTCGAGAGGGTGTGCTAGAATTTTTTGAGTTGATG
GGGTTCAAATGCCCTGAGAGGAAGGGTGTTGCGGACTTCTTACAGGAAGTAACTTCCAGG
AAAGACCAGAAGCAGTACTGGATGCAGCATGACAAGCCCTATCGGTACGTGCCAGTCAAG
GATTTTGCTAGTGCATTCCAGTCGTTCCACACTGGGAAAAGTATAGCAAACGAACTTGCT
ACTCCATTCGACAAGAGCAAAAATCATCCGGCTGCATTGACCACCTCGAGGTACGGTGTC
AGTGCCATGGAACTGTTGAAGGCAAACATCGACCGGGAGTTCTTGCTTATGAAGAGAAAT
TCCTTCGTTTATATCTTCAGAGCCTGCCAGCTGATGGTGGTGTCGGCAATTGCAATGACC
GTCTTCTTCCGTACAAAGATGCACCGTGATTCCGTGACTGATGGAGTCATCTTCATGGGC
GCACTCTTCTTCTCAGTGATGATGATAATGTTCAATGGTCTATCTGAGCTACCGCTAACC
ATTTTTAAGTTGCCAGTCTTCTTCAAGCAGAGAGACCTCTTATTCTTTCCAGCATGGACC
TACACCATACCCTCATGGATCCTCAAGATCCCAATGTCCTTTATTGAGGTCGGTGGGTTT
GTTTTCATGTCATACTATGTGATTGGGTTTGATCCGAGTGCAGGAAGGTTCTTCAAGCAG
TATCTGCTTATGTTAGCAATCAACCAGATGGCAGCGGCACTCTTCAGATTCGTTGGTGGG
GCAGCAAGGAACATGATCGTTGCGAATGTCTTTGGATCCTTCATGTTGCTAATCTTTATG
GTTCTGGGTGGTTTTATTCTAGTAAGAGAGAAAGTGAAGAAATGGTGGATTTGGGGCTAC
TGGATCTCCCCGATGATGTATGCACAGAATGCCATCTCAGTGAATGAGTTTTTGGGGCAC
AGCTGGGATAAAGTCTTGAATAATTCTCTCTCCAATGAGACCCTAGGCGTACAAGCCCTT
AGGTCCCGTGGCGTCTTCCCGGAAGCCAAGTGGTATTGGATTGGCTTTGGTGCATTGCTC
GGATTCATCATGCTCTTCAATGGTCTCTTTACTCTTGCACTAACATACCTCAAACCCTAT
GGTAAGTCCCAACCATCAGTATCTGAAGAGGAGCTGAAGGAGAAGCAAGCCAACATCAAT
GGTAATGTTCTAGACGTTGATACCATGGCATCAAGTACTAATCTAGCAATAGTTGACAAC
ACGGAAACTAGTTCAGAAATTGCTGATAATTCTCAACCTACACAAAGGGGTATGGTTCTC
CCTTTTGCTCCGCTTTCACTCACTTTCGACAACATCAAATACTCTGTCGACATGCCACAG
GAAATGAAAGCGCATGGAATAGTTGAGGACCGGTTGGAGCTCCTCAAAGGTGTCAGTGGG
TCTTTCAGGCCAGGAGTGCTAACTGCGCTTATGGGTGTTAGTGGTGCTGGAAAGACTACT
CTGATGGATGTGTTAGCAGGGAGAAAGACAGGTGGGTACATTGAAGGCAACATCACCATA
TCAGGATACCCAAAGAAACAAGAGACATTTGCACGTGTATCAGGATATTGTGAACAGAAT
GACATCCACTCACCGCAAGTAACAGTCTCAGAGTCACTGCTTTTCTCAGCTTGGCTACGG
CTTCCCAAGGATGTAGATTCAAACACAAGAAAGATGTTCATTGAGGAGGTGATGGAGCTT
GTGGAGCTCAAGCCTTTGAGAGATGCTTTAGTTGGTCTTCCTGGAGTTAATGGCCTCTCA
ACTGAGCAGAGGAAGAGGTTGACCATTGCCGTAGAGCTTGTTGCTAATCCTTCAATCATT
TTCATGGATGAGCCAACTTCAGGGCTTGATGCCCGAGCAGCTGCCATTGTGATGAGGACA
GTGAGGAATACTGTGGATACTGGTAGAACTGTGGTGTGCACAATTCATCAGCCTAGTATT
GACATATTTGAAGCATTTGATGAGCTTTTCCTTATGAAGCGAGGAGGAGAAGAAATATAT
GTTGGCCCGTTAGGCCATCAATCTTCAGAGCTGATTAAGTATTTTGAGGGAATCAAAGGA
GTCAGCAGAATTAAAGATGGCTACAATCCAGCCACGTGGATGTTGGAGGTGTCAACAATT
TCTCAAGAACAGGCATTAGGTGTTGATTTTTGTGACATATACAGGAAATCTGAACTCTTC
CAGAGGAACAAGGCATTGATACAGGAACTGAGCACACCACCACCAGGTTCGAGTGAACTA
TATTTCCCTACAAAGTACTCGCTATCTTTCTTAAATCAATGCCTAGCATGCCTGTGGAAG
ATGCACCTGTCATACTGGAGGAACCCTCCTTACAATGCCATAAGATTATTTTTCACTACT
GTCATAGCTCTCCTCTTTGGCACCATCTTCTGGGATCTTGGCGGTAAAACGGGCAAGTCA
CAAGACTTGTTCAATGCCATGGGGTCCATGTATTCCGCAGTGCTTTTTATTGGCGTCCTA
AACTCTCAGTCAGTTCAGCCAGTTGTATCAGTGGAGAGGACAGTCTTTTATCGTGAAAGA
GCTGCTGGCATGTATTCAGCTTTCCCGTATGCATTTGGACAGGTTGCCATCGAATTCCCG
TATACACTGGTTCAGTCTATCATATATGGCATCATAGTGTACTCGATGATTGGTTTTAAA
TGGACGGCGGCTAAATTCTTCTGGTACCTCTTCTTCATGTTCTTCACGTTTCTATACTTC
ACATTCTATGGCATGATGGCTGTGGGCCTGACACCAAGCTACCACGTCGCCTCAATCGTC
TCATCGGCTTTCTATGGCATCTGGAACCTATTCTCCGGGTTCATCATCCCCAGACCGAAA
GTTCCAATCTGGTGGAGATGGTACTGCTGGATATGCCCTGTCGCGTGGACGCTGTACGGT
CTGGTTGCCTCGCAGTTTGGAGACATTATGACGCCAATGGATGATGGCACTCCCGTGAAA
ATCTTCGTGGAGAACTACTTCGACTTCAAGCATAGCTGGCTGGGGGTGGTGGCCGTGGTG
ATCGTCGCATTCACCATGTTATTTGCCTTCCTCTTTGGCTTTGCCATCATGAAGCTTAAC
TTCCAGAAGAGATAG

CDS

4395 bp

>Os01t0609200-00 Similar to Pleiotropic drug resistance protein 3.
ATGGATGCGGCGGCGGAGATGCAGAAGGTGGTGAGCCTGAGGAGAGGGGGAGGGGGGTCG
TCGTCGCGGGGGGCGGCGTCGATGTGGTGGAGCGCGGACAACGGGGTGTTCTCGCGGTCG
AGGGCGTCGTCGAGTGGGGAGGATGGGGAGGACGACGAGGAGGCGCTGCGGTGGGCGGCG
CTCGAGAAGCTGCCCACGTACGACCGCGTGCGCCGCGCCGTACTGCCGGTGGTGGAGGAG
GGCGGCGGCGGAGGGGAGGCGGGGAAGAAGGTGGTGGACGTGCTCAGCCTCGGCCCGCAG
GAGCGGCGGGCGCTGCTCGAGCGGCTCGTGCGCGTCGCCGAGGACGACAACGAGCGCTTC
CTTCTCAAGCTCAAGGAGCGCATCGACCGGGTGGGGATTGATATTCCGACGATCGAGGTG
CGGTTCGAGCACCTGGAGGCGGAGGCGGAGGTCCGCGTCGGCAACAGCGGCCTCCCCACC
GTCCTCAACTCCATGACCAACAAGCTCGAGGGAGCCGCGAACGCGCTGGGGATTCTACCC
AACAAGAAGCAGACCATGCCCATCCTCCACGACGTCAGCGGCATCGTCAAGCCCCGCAGG
ATGACTCTGCTGTTAGGACCTCCCGGGTCTGGCAAGACCACCTTGCTACTTGCTTTGGCT
GGAAGGCTTGGCAAAGACATCAAGTTCTCTGGTCAAGTGACTTACAATGGACACCAGATG
GAGGATTTTGTGCCACAGAGGACAGCTGCATACATCAGCCAGCATGATCTTCATATTGGG
GAAATGACTGTTCGGGAGACACTCTCATTCTCGGCACGCTGCCAGGGTGTTGGAAGCCGC
TTTGATATGCTGACCGAGCTGTCAAGGCGAGAGAAGGCAGCAAATATTAAGCCTGATGCT
GATATTGATGCGTTTATGAAGGCTTCAGCGATGGAGGGACAAGAGACCAATTTGATTACT
GACTATATACTGAAGATATTAGGACTGGATATATGTGCAGACACGATGGTAGGAGATGAT
ATGGTGAGGGGTATCTCCGGTGGACAACGGAAGCGTGTCACCACAGGTGAGATGCTTGTT
GGGCCAGCCAATGCACTTTTCATGGATGAGATATCGACTGGGCTCGACAGCTCAACTACA
TTTCAGATCGTGAAGTCGCTCAGACAGGCCATCCACATCCTCGGTGGCACAGCAGTCATC
TCGCTGTTGCAGCCAGCTCCAGAGACATATGACCTATTTGACGACATCATACTCCTCTCT
GATGGTCAGATTGTATACCAGGGGCCTCGAGAGGGTGTGCTAGAATTTTTTGAGTTGATG
GGGTTCAAATGCCCTGAGAGGAAGGGTGTTGCGGACTTCTTACAGGAAGTAACTTCCAGG
AAAGACCAGAAGCAGTACTGGATGCAGCATGACAAGCCCTATCGGTACGTGCCAGTCAAG
GATTTTGCTAGTGCATTCCAGTCGTTCCACACTGGGAAAAGTATAGCAAACGAACTTGCT
ACTCCATTCGACAAGAGCAAAAATCATCCGGCTGCATTGACCACCTCGAGGTACGGTGTC
AGTGCCATGGAACTGTTGAAGGCAAACATCGACCGGGAGTTCTTGCTTATGAAGAGAAAT
TCCTTCGTTTATATCTTCAGAGCCTGCCAGCTGATGGTGGTGTCGGCAATTGCAATGACC
GTCTTCTTCCGTACAAAGATGCACCGTGATTCCGTGACTGATGGAGTCATCTTCATGGGC
GCACTCTTCTTCTCAGTGATGATGATAATGTTCAATGGTCTATCTGAGCTACCGCTAACC
ATTTTTAAGTTGCCAGTCTTCTTCAAGCAGAGAGACCTCTTATTCTTTCCAGCATGGACC
TACACCATACCCTCATGGATCCTCAAGATCCCAATGTCCTTTATTGAGGTCGGTGGGTTT
GTTTTCATGTCATACTATGTGATTGGGTTTGATCCGAGTGCAGGAAGGTTCTTCAAGCAG
TATCTGCTTATGTTAGCAATCAACCAGATGGCAGCGGCACTCTTCAGATTCGTTGGTGGG
GCAGCAAGGAACATGATCGTTGCGAATGTCTTTGGATCCTTCATGTTGCTAATCTTTATG
GTTCTGGGTGGTTTTATTCTAGTAAGAGAGAAAGTGAAGAAATGGTGGATTTGGGGCTAC
TGGATCTCCCCGATGATGTATGCACAGAATGCCATCTCAGTGAATGAGTTTTTGGGGCAC
AGCTGGGATAAAGTCTTGAATAATTCTCTCTCCAATGAGACCCTAGGCGTACAAGCCCTT
AGGTCCCGTGGCGTCTTCCCGGAAGCCAAGTGGTATTGGATTGGCTTTGGTGCATTGCTC
GGATTCATCATGCTCTTCAATGGTCTCTTTACTCTTGCACTAACATACCTCAAACCCTAT
GGTAAGTCCCAACCATCAGTATCTGAAGAGGAGCTGAAGGAGAAGCAAGCCAACATCAAT
GGTAATGTTCTAGACGTTGATACCATGGCATCAAGTACTAATCTAGCAATAGTTGACAAC
ACGGAAACTAGTTCAGAAATTGCTGATAATTCTCAACCTACACAAAGGGGTATGGTTCTC
CCTTTTGCTCCGCTTTCACTCACTTTCGACAACATCAAATACTCTGTCGACATGCCACAG
GAAATGAAAGCGCATGGAATAGTTGAGGACCGGTTGGAGCTCCTCAAAGGTGTCAGTGGG
TCTTTCAGGCCAGGAGTGCTAACTGCGCTTATGGGTGTTAGTGGTGCTGGAAAGACTACT
CTGATGGATGTGTTAGCAGGGAGAAAGACAGGTGGGTACATTGAAGGCAACATCACCATA
TCAGGATACCCAAAGAAACAAGAGACATTTGCACGTGTATCAGGATATTGTGAACAGAAT
GACATCCACTCACCGCAAGTAACAGTCTCAGAGTCACTGCTTTTCTCAGCTTGGCTACGG
CTTCCCAAGGATGTAGATTCAAACACAAGAAAGATGTTCATTGAGGAGGTGATGGAGCTT
GTGGAGCTCAAGCCTTTGAGAGATGCTTTAGTTGGTCTTCCTGGAGTTAATGGCCTCTCA
ACTGAGCAGAGGAAGAGGTTGACCATTGCCGTAGAGCTTGTTGCTAATCCTTCAATCATT
TTCATGGATGAGCCAACTTCAGGGCTTGATGCCCGAGCAGCTGCCATTGTGATGAGGACA
GTGAGGAATACTGTGGATACTGGTAGAACTGTGGTGTGCACAATTCATCAGCCTAGTATT
GACATATTTGAAGCATTTGATGAGCTTTTCCTTATGAAGCGAGGAGGAGAAGAAATATAT
GTTGGCCCGTTAGGCCATCAATCTTCAGAGCTGATTAAGTATTTTGAGGGAATCAAAGGA
GTCAGCAGAATTAAAGATGGCTACAATCCAGCCACGTGGATGTTGGAGGTGTCAACAATT
TCTCAAGAACAGGCATTAGGTGTTGATTTTTGTGACATATACAGGAAATCTGAACTCTTC
CAGAGGAACAAGGCATTGATACAGGAACTGAGCACACCACCACCAGGTTCGAGTGAACTA
TATTTCCCTACAAAGTACTCGCTATCTTTCTTAAATCAATGCCTAGCATGCCTGTGGAAG
ATGCACCTGTCATACTGGAGGAACCCTCCTTACAATGCCATAAGATTATTTTTCACTACT
GTCATAGCTCTCCTCTTTGGCACCATCTTCTGGGATCTTGGCGGTAAAACGGGCAAGTCA
CAAGACTTGTTCAATGCCATGGGGTCCATGTATTCCGCAGTGCTTTTTATTGGCGTCCTA
AACTCTCAGTCAGTTCAGCCAGTTGTATCAGTGGAGAGGACAGTCTTTTATCGTGAAAGA
GCTGCTGGCATGTATTCAGCTTTCCCGTATGCATTTGGACAGGTTGCCATCGAATTCCCG
TATACACTGGTTCAGTCTATCATATATGGCATCATAGTGTACTCGATGATTGGTTTTAAA
TGGACGGCGGCTAAATTCTTCTGGTACCTCTTCTTCATGTTCTTCACGTTTCTATACTTC
ACATTCTATGGCATGATGGCTGTGGGCCTGACACCAAGCTACCACGTCGCCTCAATCGTC
TCATCGGCTTTCTATGGCATCTGGAACCTATTCTCCGGGTTCATCATCCCCAGACCGAAA
GTTCCAATCTGGTGGAGATGGTACTGCTGGATATGCCCTGTCGCGTGGACGCTGTACGGT
CTGGTTGCCTCGCAGTTTGGAGACATTATGACGCCAATGGATGATGGCACTCCCGTGAAA
ATCTTCGTGGAGAACTACTTCGACTTCAAGCATAGCTGGCTGGGGGTGGTGGCCGTGGTG
ATCGTCGCATTCACCATGTTATTTGCCTTCCTCTTTGGCTTTGCCATCATGAAGCTTAAC
TTCCAGAAGAGATAG

Protein

1464 aa

>Os01t0609200-00 Similar to Pleiotropic drug resistance protein 3.
MDAAAEMQKVVSLRRGGGGSSSRGAASMWWSADNGVFSRSRASSSGEDGEDDEEALRWAA
LEKLPTYDRVRRAVLPVVEEGGGGGEAGKKVVDVLSLGPQERRALLERLVRVAEDDNERF
LLKLKERIDRVGIDIPTIEVRFEHLEAEAEVRVGNSGLPTVLNSMTNKLEGAANALGILP
NKKQTMPILHDVSGIVKPRRMTLLLGPPGSGKTTLLLALAGRLGKDIKFSGQVTYNGHQM
EDFVPQRTAAYISQHDLHIGEMTVRETLSFSARCQGVGSRFDMLTELSRREKAANIKPDA
DIDAFMKASAMEGQETNLITDYILKILGLDICADTMVGDDMVRGISGGQRKRVTTGEMLV
GPANALFMDEISTGLDSSTTFQIVKSLRQAIHILGGTAVISLLQPAPETYDLFDDIILLS
DGQIVYQGPREGVLEFFELMGFKCPERKGVADFLQEVTSRKDQKQYWMQHDKPYRYVPVK
DFASAFQSFHTGKSIANELATPFDKSKNHPAALTTSRYGVSAMELLKANIDREFLLMKRN
SFVYIFRACQLMVVSAIAMTVFFRTKMHRDSVTDGVIFMGALFFSVMMIMFNGLSELPLT
IFKLPVFFKQRDLLFFPAWTYTIPSWILKIPMSFIEVGGFVFMSYYVIGFDPSAGRFFKQ
YLLMLAINQMAAALFRFVGGAARNMIVANVFGSFMLLIFMVLGGFILVREKVKKWWIWGY
WISPMMYAQNAISVNEFLGHSWDKVLNNSLSNETLGVQALRSRGVFPEAKWYWIGFGALL
GFIMLFNGLFTLALTYLKPYGKSQPSVSEEELKEKQANINGNVLDVDTMASSTNLAIVDN
TETSSEIADNSQPTQRGMVLPFAPLSLTFDNIKYSVDMPQEMKAHGIVEDRLELLKGVSG
SFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGNITISGYPKKQETFARVSGYCEQN
DIHSPQVTVSESLLFSAWLRLPKDVDSNTRKMFIEEVMELVELKPLRDALVGLPGVNGLS
TEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSI
DIFEAFDELFLMKRGGEEIYVGPLGHQSSELIKYFEGIKGVSRIKDGYNPATWMLEVSTI
SQEQALGVDFCDIYRKSELFQRNKALIQELSTPPPGSSELYFPTKYSLSFLNQCLACLWK
MHLSYWRNPPYNAIRLFFTTVIALLFGTIFWDLGGKTGKSQDLFNAMGSMYSAVLFIGVL
NSQSVQPVVSVERTVFYRERAAGMYSAFPYAFGQVAIEFPYTLVQSIIYGIIVYSMIGFK
WTAAKFFWYLFFMFFTFLYFTFYGMMAVGLTPSYHVASIVSSAFYGIWNLFSGFIIPRPK
VPIWWRWYCWICPVAWTLYGLVASQFGDIMTPMDDGTPVKIFVENYFDFKHSWLGVVAVV
IVAFTMLFAFLFGFAIMKLNFQKR*

CDS

chr01:24073233..24073621 (- strand) : 389 bp

chr01:24072918..24073127 (- strand) : 210 bp

chr01:24072542..24072626 (- strand) : 85 bp

chr01:24072048..24072207 (- strand) : 160 bp

chr01:24071852..24071928 (- strand) : 77 bp

chr01:24071685..24071738 (- strand) : 54 bp

chr01:24071287..24071377 (- strand) : 91 bp

chr01:24070913..24071214 (- strand) : 302 bp

chr01:24070554..24070835 (- strand) : 282 bp

chr01:24070142..24070458 (- strand) : 317 bp

chr01:24069886..24070046 (- strand) : 161 bp

chr01:24069533..24069799 (- strand) : 267 bp

chr01:24069034..24069278 (- strand) : 245 bp

chr01:24068602..24068934 (- strand) : 333 bp

chr01:24067989..24068279 (- strand) : 291 bp

chr01:24067711..24067794 (- strand) : 84 bp

chr01:24067490..24067623 (- strand) : 134 bp

chr01:24066147..24066374 (- strand) : 228 bp

chr01:24065890..24066061 (- strand) : 172 bp

chr01:24065553..24065807 (- strand) : 255 bp

chr01:24065207..24065464 (- strand) : 258 bp

FASTA

>Os01t0609200-00 class=Sequence position=chr01:24065207..24073621 (- strand)
ATGGATGCGG CGGCGGAGAT GCAGAAGGTG GTGAGCCTGA GGAGAGGGGG AGGGGGGTCG TCGTCGCGGG GGGCGGCGTC
GATGTGGTGG AGCGCGGACA ACGGGGTGTT CTCGCGGTCG AGGGCGTCGT CGAGTGGGGA GGATGGGGAG GACGACGAGG
AGGCGCTGCG GTGGGCGGCG CTCGAGAAGC TGCCCACGTA CGACCGCGTG CGCCGCGCCG TACTGCCGGT GGTGGAGGAG
GGCGGCGGCG GAGGGGAGGC GGGGAAGAAG GTGGTGGACG TGCTCAGCCT CGGCCCGCAG GAGCGGCGGG CGCTGCTCGA
GCGGCTCGTG CGCGTCGCCG AGGACGACAA CGAGCGCTTC CTTCTCAAGC TCAAGGAGCG CATCGACCGG TGCGTACTGT
GCTGTACCAC ACTGCGTCAC GATGTCGCCG TGGCGGCGGA CGCGGTTGCC TGCAGGGTGT TTGATGATTT GCGCGTGGTA
ATTTTGATGT GCAGGGTGGG GATTGATATT CCGACGATCG AGGTGCGGTT CGAGCACCTG GAGGCGGAGG CGGAGGTCCG
CGTCGGCAAC AGCGGCCTCC CCACCGTCCT CAACTCCATG ACCAACAAGC TCGAGGGAGC CGCGAACGCG CTGGGGATTC
TACCCAACAA GAAGCAGACC ATGCCCATCC TCCACGACGT CAGCGGCATC GTCAAGCCCC GCAGGTGAAA GAAAGAAAAA
GAAGCATCAC GTTTTCAAAA TTGCTTATGC TTTATATAAC GTTACGTGTG TGCTGCTCTC ATGGTTTATT TGCGATTTTT
TGAAGCATTG TAAGATATTT GCTTGAAGAT ATTTTTGTAC GGGATGCCGG TTCCCAGGAA ACGAAATGCT TTTCAATTAG
ACATGTCCCT GTAAACTGTA AAGTTGATTT GTCTTTGTTG GAGCCTAGAT TAACCAAGAT CATTTGGAAT TTAACTTCTA
TGCTTCTCCT ATAACACGTT CTTTTGATTA TGCAGGATGA CTCTGCTGTT AGGACCTCCC GGGTCTGGCA AGACCACCTT
GCTACTTGCT TTGGCTGGAA GGCTTGGCAA AGACATCAAG GTTTCAAACA AATTTTATTT ACTTATTTTG CAATAACTGC
GATATAACGA TGCGTTTGGG CGTTTGGCAA ACCAGTCCAT ATTCCCACAG ATGTGTGTAC TTCATCTTTA ATATATTGTA
TACGATTAGC GAAAATACAG AGAACATACT TTTAGAGAAT TAATGCATAA AGGCTTACGC ATCATTGCAT TAAGTTGGTA
GAAACAAACA AAGTTCGCAT GAACAGATAA CTTTTCTTAG GTGACATGTC CCAAAAACTG TATACCTTGC TCTTGAGTGA
TATTACTGAT AACTGACATA CACAATGCAT AATGGGGGGA AAACTAATTT GCAGTTCTCT GGTCAAGTGA CTTACAATGG
ACACCAGATG GAGGATTTTG TGCCACAGAG GACAGCTGCA TACATCAGCC AGCATGATCT TCATATTGGG GAAATGACTG
TTCGGGAGAC ACTCTCATTC TCGGCACGCT GCCAGGGTGT TGGAAGCCGC TTTGGTATGA CTATGTGCAA GGAACAACCA
CAAGTGCATG CATTCTTTTC TGCAGAATTC GCCTTTTGAG AAAATCGTCA TGGGTTGACT GATACTTATA GAGTTCTCTT
GTTATGTCAT TAGATATGCT GACCGAGCTG TCAAGGCGAG AGAAGGCAGC AAATATTAAG CCTGATGCTG ATATTGATGC
GTTTATGAAG GTAAAAATTG CAAATCCTAT ATAAATCAGA ATTATTCTGG TGTCTGTAGA TATGATTTTC ATACGAGGTA
TGAGTGAAGT TTTGCTATAA ATTTTCTGTC CTAACTTGAT CAGGCTTCAG CGATGGAGGG ACAAGAGACC AATTTGATTA
CTGACTATAT ACTGAAGGTA CATGCATCTC TGAGCTACAA TAGCtactac ctccgtttca ggttatgaga ctttctagca
ttgcccacat tcataaagat gttaatgaat ctaggcacat atatatgtct agattcatta acatatatat gaatgtgggc
gatgctagaa aatcttataa cctatgtgcc tagattcatt aacatatata tgaatgtggg caatgctaga aagtcttata
atatgaaacg gaggaagtaC TTACTTCAGA TTGGATTAAG CAAATTCGTT TTATTTACTA CTTTACATAT GTAACATGTT
GCAGATATTA GGACTGGATA TATGTGCAGA CACGATGGTA GGAGATGATA TGGTGAGGGG TATCTCCGGT GGACAACGGA
AGCGTGTCAC CACAGGTTGA AAAATAGAAT TTCACTTTCA GAACATGGGA TTTGCTGGAC AATGTTTTGA TTGACTGTTT
CTTCCAGGTG AGATGCTTGT TGGGCCAGCC AATGCACTTT TCATGGATGA GATATCGACT GGGCTCGACA GCTCAACTAC
ATTTCAGATC GTGAAGTCGC TCAGACAGGC CATCCACATC CTCGGTGGCA CAGCAGTCAT CTCGCTGTTG CAGCCAGCTC
CAGAGACATA TGACCTATTT GACGACATCA TACTCCTCTC TGATGGTCAG ATTGTATACC AGGGGCCTCG AGAGGGTGTG
CTAGAATTTT TTGAGTTGAT GGGGTTCAAA TGCCCTGAGA GGAAGGGTGT TGCGGACTTC TTACAGGAAG TGAGTGAGTC
TACTATCTTC AAAAATGTAT ATGCACAAAT TTATCGGTTA TTTATCAACA TGGAAATACC GAACAGGTAA CTTCCAGGAA
AGACCAGAAG CAGTACTGGA TGCAGCATGA CAAGCCCTAT CGGTACGTGC CAGTCAAGGA TTTTGCTAGT GCATTCCAGT
CGTTCCACAC TGGGAAAAGT ATAGCAAACG AACTTGCTAC TCCATTCGAC AAGAGCAAAA ATCATCCGGC TGCATTGACC
ACCTCGAGGT ACGGTGTCAG TGCCATGGAA CTGTTGAAGG CAAACATCGA CCGGGAGTTC TTGCTTATGA AGAGAAATTC
CTTCGTTTAT ATCTTCAGAG CCTGCCAGGT TGTTAGGGAT CCATTCAAAC AAATGGAGTA TTAGTATATT TGAGAAAACA
AACAACATCA TACGACTGAC TTCTTGTTGA ATTGCTATGG CAGCTGATGG TGGTGTCGGC AATTGCAATG ACCGTCTTCT
TCCGTACAAA GATGCACCGT GATTCCGTGA CTGATGGAGT CATCTTCATG GGCGCACTCT TCTTCTCAGT GATGATGATA
ATGTTCAATG GTCTATCTGA GCTACCGCTA ACCATTTTTA AGTTGCCAGT CTTCTTCAAG CAGAGAGACC TCTTATTCTT
TCCAGCATGG ACCTACACCA TACCCTCATG GATCCTCAAG ATCCCAATGT CCTTTATTGA GGTCGGTGGG TTTGTTTTCA
TGTCATACTA TGTGATTGGG TTTGATCCGA GTGCAGGAAG GTGAGATTTT TGGACAAAAT CTTATTTGGT CAGTATAATT
TATCCAATTT CTTTCACTAG CTATTCTTTA CTCCTGAACT GTTGCGCGGC ATTAGGTTCT TCAAGCAGTA TCTGCTTATG
TTAGCAATCA ACCAGATGGC AGCGGCACTC TTCAGATTCG TTGGTGGGGC AGCAAGGAAC ATGATCGTTG CGAATGTCTT
TGGATCCTTC ATGTTGCTAA TCTTTATGGT TCTGGGTGGT TTTATTCTAG TAAGAGGTAA AACTTCATCT CTGTACTATG
TAGTTCTTCT CATTGTTGCA TTTTTTAGTA AGTCAGGTTC TTATTCATGT ATGTACTGGC AGAGAAAGTG AAGAAATGGT
GGATTTGGGG CTACTGGATC TCCCCGATGA TGTATGCACA GAATGCCATC TCAGTGAATG AGTTTTTGGG GCACAGCTGG
GATAAAGTCT TGAATAATTC TCTCTCCAAT GAGACCCTAG GCGTACAAGC CCTTAGGTCC CGTGGCGTCT TCCCGGAAGC
CAAGTGGTAT TGGATTGGCT TTGGTGCATT GCTCGGATTC ATCATGCTCT TCAATGGTCT CTTTACTCTT GCACTAACAT
ACCTCAAACG TGAGTTCCTT CCGAATTGGT TTGCTTTTGT TTTCTTTCTT TTCTTTTGAA AGAAAAGTGT GGCAAAAGCT
CTGCATCATT TCAAGAAAAT AGGGAGAAGA TAATGCAAAC AAACCGAAAA TATGGTAGAG ACTAAACAAT AAGACAACAA
AAATAAAATA TGACACAGCA ACACAAAAAA GCACCTCAAA TCATCAAAGT TTGTTCATTG TTCTTACCTC AGAACGGTTT
TATCTTCCGA TTTTACATTA CAGCCTATGG TAAGTCCCAA CCATCAGTAT CTGAAGAGGA GCTGAAGGAG AAGCAAGCCA
ACATCAATGG TAATGTTCTA GACGTTGATA CCATGGCATC AAGTACTAAT CTAGCAATAG TTGACAACAC GGAAACTAGT
TCAGAAATTG CTGATAATTC TCAACCTACA CAAAGGGGTA TGGTTCTCCC TTTTGCTCCG CTTTCACTCA CTTTCGACAA
CATCAAATAC TCTGTCGACA TGCCACAGGT AACATATTTT AATTCCTTAA CTTATATTGT CCACCAGTGA GTCATTAATG
ACAATTTTGT CGTGACCTTT TGTATCAAAT TAAAATTCAA AAATCAGGAA ATGAAAGCGC ATGGAATAGT TGAGGACCGG
TTGGAGCTCC TCAAAGGTGT CAGTGGGTCT TTCAGGCCAG GAGTGCTAAC TGCGCTTATG GGTGTTAGTG GTGCTGGAAA
GACTACTCTG ATGGATGTGT TAGCAGGGAG AAAGACAGGT GGGTACATTG AAGGCAACAT CACCATATCA GGATACCCAA
AGAAACAAGA GACATTTGCA CGTGTATCAG GATATTGTGA ACAGAATGAC ATCCACTCAC CGCAAGTAAC AGTCTCAGAG
TCACTGCTTT TCTCAGCTTG GCTACGGCTT CCCAAGGATG TAGATTCAAA CACAAGAAAG GTCAGTCAAA AAAAATATTT
TTAATTCCTT CTCTCAGCTT ATAATCAATT Gtttaaattg tttttatttt tattttggag aagggtattt cttacccggc
ctctacatcc aaccgaatat atgcagcctt tttaaagtag gaacttagcc tatcaaacag ggaacttatc tctcaaataa
cctaatctga aattcgctcc tatagagatt tgaactcagg actttcgggt gctactcagg tcACTGCAAC CACTAAGCTA
CATGCCCTTT CAACTGAGCA GAGAAGGGTA TTGTTTAAGT TGTTTAACCT TTCTCTATGC AGATGTTCAT TGAGGAGGTG
ATGGAGCTTG TGGAGCTCAA GCCTTTGAGA GATGCTTTAG TTGGTCTTCC TGGAGTTAAT GGCCTCTCAA CTGAGCAGAG
GAAGAGGTTG ACCATTGCCG TAGAGCTTGT TGCTAATCCT TCAATCATTT TCATGGATGA GCCAACTTCA GGGCTTGATG
CCCGAGCAGC TGCCATTGTG ATGAGGACAG TGAGGAATAC TGTGGATACT GGTAGAACTG TGGTGTGCAC AATTCATCAG
CCTAGTATTG ACATATTTGA AGCATTTGAT GAGGTGAGCA TACCTTGGAA TATCTGCTAC ACCTTTTGGT GAACTCTTAT
CGGTTTTGTA ATATGGAATA ACTGGGTTAA CTTATTAAAA TTTAACTTAT TTTGGCTGAT TTTCCAAACT TTTAATGTGA
CCAATGCTTT ATTGTCCTAA ACTTTAGATA ATGTGCAGGG TCCTAAATGT TTTATTAATT ATTGCAGCTT TTCCTTATGA
AGCGAGGAGG AGAAGAAATA TATGTTGGCC CGTTAGGCCA TCAATCTTCA GAGCTGATTA AGTATTTTGA GGTATAGTAA
TGTTATAAAA GTTCTAATAT ACCTCTTTTT GGTTTGTTCG ATACTGTTGT TAATCTTATA TTGTTTCGTG TTCTCAAGGG
AATCAAAGGA GTCAGCAGAA TTAAAGATGG CTACAATCCA GCCACGTGGA TGTTGGAGGT GTCAACAATT TCTCAAGAAC
AGGCATTAGG TGTTGATTTT TGTGACATAT ACAGGAAATC TGAACTCTTC CAGTAAGTAA TTACTATTAT GTTAAATCCT
GTAAATCAAA TAGTTGACTC ACTTTGAATC TTGGTAGTGA AAGCTAGAAT CTCCTTAGCT GCTTTATGTA TGGTGGTGAC
AAACCAACAA GAGTAAATAA GTAGGCTTCA ATACAGTTGG TCAGATTTAC ATGGCTTCTA CAGATAATGC ATCATACTAC
TGCAAGTATG CTACTAACAA TTTAGCTTGT GATAAAATTC AAGACAATCG GTTTGTTCAT GCCATTACAT ATTGCAGTTT
TCGGTAGCAT TGGACTTTCT TTTCTCCAAA GCAGTTTTGT TGTGGCTGAA CTTGCATCAA CTATTGCCAG CGTCTTAACT
TGCTGGTTAT AGAATGCTAG CAGCATTGTC AAGGTTTGAT TTCAGAATAC TATGCTATAT AGCAAATGGA CAAGAGCTAG
AGTGGCTCCA TTACCACTGC AGCTCTACAA CAAATAGTGG TAGTGTGCTC CACAGGTCAA ATTCATATTA CTACTGCAAA
CTGTTGTGCG ACATGCCGAC ATGAGTCATT TTCACATTTC ATATGTTCAT ATGTTTGAAG TTTCAAAGGT TTTAAATTTC
CTGATAATTT CTTTTTTTTG CATTTATGAA TAATTAGGAA TTAAACTAAG CCTCtttttt ttgaacgaac tggcacagag
tgtgccagtt tcattgaata tagtgggagt aaaagttatt tacaggtgtg aaaggaaaaa aaaactatac aaccattatc
gacaggacgc tagatttaca ggaggagctg tgttagcttc tttgcatccg cgagtaccca tgttttccct tccttgattt
tcgctaacag aaTTAAGCTA AGGCTGTACT TCTACATGGA TAAAGATTTG CTTTAATATC TTATCATCAA TTAGATTACC
ATATAGCTAT GATACACACA TGTTTGCCTT TTATGCGCTT CATGTACACT TCTGAGTTTT CAGTGGACAT CCAAAAGTGT
GAAATTAGAA GTGGGAAGAT TTAGTATGAC CTCTCTGAAA ACTTTTTAAC TAAGTGGTAG CTGTTTCCAA CACATTGCTA
TGAAATATGA TAATTGCAAT CTGAACATTG ATTACTGCCA TTTATAGGAG GAACAAGGCA TTGATACAGG AACTGAGCAC
ACCACCACCA GGTTCGAGTG AACTATATTT CCCTACAAAG TACTCGCTAT CTTTCTTAAA TCAATGCCTA GCATGCCTGT
GGAAGATGCA CCTGTCATAC TGGAGGAACC CTCCTTACAA TGCCATAAGA TTATTTTTCA CTACTGTCAT AGCTCTCCTC
TTTGGCACCA TCTTCTGGGA TCTTGGCGGT AAAACGTATG TACCCTACCT TGTACATATC AAGCATATGA CTAAACCATC
TTCAAAATGT TATTTATGCG CCTTTTGCTT CTTGCTCCAG GGGCAAGTCA CAAGACTTGT TCAATGCCAT GGGGTCCATG
TATTCCGCAG TGCTTTTTAT TGGCGTCCTA AACTCTCAGT CAGTTCAGCC AGTTGTATCA GTGGAGAGGA CAGTCTTTTA
TCGTGAAAGA GCTGCTGGCA TGTATTCAGC TTTCCCGTAT GCATTTGGAC AGGTACGTAG CTCTCATATC AATTCGGCAA
TGCCAGATTC TGCTTTGCTG AGAAACCTGG CAGTAATCAA CTTCTCCCTT ACAGGTTGCC ATCGAATTCC CGTATACACT
GGTTCAGTCT ATCATATATG GCATCATAGT GTACTCGATG ATTGGTTTTA AATGGACGGC GGCTAAATTC TTCTGGTACC
TCTTCTTCAT GTTCTTCACG TTTCTATACT TCACATTCTA TGGCATGATG GCTGTGGGCC TGACACCAAG CTACCACGTC
GCCTCAATCG TCTCATCGGC TTTCTATGGC ATCTGGAACC TATTCTCCGG GTTCATCATC CCCAGACCGG TAACCGTCGT
CATCCTTATG ACCCTGCCTT TAATTTCGTT TCATCATTTC TATAGCTCAT TTCCATTCCC CTGACCCATG TGCTCAGAAA
GTTCCAATCT GGTGGAGATG GTACTGCTGG ATATGCCCTG TCGCGTGGAC GCTGTACGGT CTGGTTGCCT CGCAGTTTGG
AGACATTATG ACGCCAATGG ATGATGGCAC TCCCGTGAAA ATCTTCGTGG AGAACTACTT CGACTTCAAG CATAGCTGGC
TGGGGGTGGT GGCCGTGGTG ATCGTCGCAT TCACCATGTT ATTTGCCTTC CTCTTTGGCT TTGCCATCAT GAAGCTTAAC
TTCCAGAAGA GATAG

Locus: Os01g0609200

Loading...

Locus: Os01g0609200

Loading...