Os01t0609300-01

Locus

Os01g0609300

Description

PDR-type ABC transporter 9

RAP-DB Gene Symbol Synonym(s)

OsPDR9

RAP-DB Gene Name Synonym(s)

pleiotropic drug resistance 9, PDR-type ABC transporter 9

CGSNL Gene Symbol

PDR9

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 9

Oryzabase Gene Symbol Synonym(s)

OsPDR9, ospdr9, OsPDR3, PDR3, OsABCG36/OsPDR9, OsABCG36

Oryzabase Gene Name Synonym(s)

pleiotropic drug resistance 9, PDR-type ABC transporter 9, sativa pleiotropic drug resistance 3, pleiotropic drug resistance 3, Pleiotropic drug resistance protein 3

Transcript Evidence

AK100135 (truncated)

AY271618 (Pokkali)

Inferred from literature

Protein Evidence

Q0JLC5

Literature

PMID: 14572653

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

December 9, 2021

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

ABC-transporter N-terminal domain (IPR029481)

ABC transporter-like (IPR003439)

AAA+ ATPase domain (IPR003593)

ABC-2 type transporter (IPR013525)

Plant PDR ABC transporter associated (IPR013581)

ATP-binding cassette transporter, PDR-like subfamily G, domain 2 (IPR034003)

Full-length cDNA

J023010G13(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os01t0609300-01)

RiceXPro (AK100135)

Others

Oryzabase (8341)

KEGG (Os01t0609300-01)

Transcript

4911 bp

>Os01t0609300-01 PDR-type ABC transporter 9
AAACACACCACACCCCGCGCCGCGCCGCGCCTTCACTTGCAAAAGCCCGGAAGAAATCCC
GGTGCCGCGCCGCGCAGCGCAGCGCGCAGACTGCGAGGAATCGGAATCACAACAATCACC
CACCTCGAGAAGCGCACAACGGAGAGGGATTAGAATTGATAGCTCTCGGCGAGGAGGTTT
TGGTGGTGGTGGGAGATGGACGCGGCGGGGGAGATCCAGAAGGTGGCGAGCATGCGGCTA
GGGGGGAGCATGAGGGGGGACAGCGGGTCGATGTGGAGGAGAGGGGACGACGTGTTCTCG
AGGTCGTCGAGGGAGGAGGACGACGAGGAGGCGCTGCGGTGGGCGGCGCTCGAGAAGCTG
CCCACCTACGACCGCGTGCGCCGCGCCATCCTGCCGCTCGGTGGCGACGACGGCGCCGGG
GACGGAGGAGGGAAGGGCGTCGTGGACGTGCACGGGCTCGGCCCGCGCGAGCGCCGCGCG
CTCCTCGAGCGCCTCGTGCGCGTCGCCGACGAGGACAACGAGAAGTTCCTCCTCAAGCTC
AAGGACCGCGTCGACCGGGTGGGGATCGACATGCCGACGATCGAGGTGCGGTTCGAGCAC
CTGGAGGCGGAGGCGGAGGTCCGCGTCGGCAACAGCGGCCTCCCCACCGTCCTCAACTCC
ATCACCAACACCCTCGAGGAAGCCGGCAACGCGCTCGGCATTCTGCCCAACCGGAAGCAG
ACCATGCCCGTCCTCCACGACGTCAGCGGCATCATCAAGCCCCGCAGGATGACTCTGCTG
TTAGGCCCACCGGGGTCAGGCAAGACCACCTTGCTGCTCGCGTTGGCCGGAAGGCTCGGC
AAAGATCTCAAGGCTTCAGGAAAAGTGACCTACAACGGGCACGGCATGGAGGAATTCGTG
CCGGAGAGGACGGCGGCTTACATCAGCCAGCACGACCTCCACATCGGAGAGATGACCGTC
AGGGAGACACTTGCCTTCTCGGCACGATGCCAGGGTGTTGGCAGTCGCTTTGATATGTTG
ACTGAGCTGTCAAGGCGAGAGAAGGCAGCGAACATTAAGCCTGACGCCGATATCGATGCA
TTCATGAAGGCGGCTGCAATGGGAGGACAGGAGGCAAACGTGAACACTGACTATATACTG
AAGATATTAGGACTAGAGATATGCGCTGACACGATGGTTGGGGACGAGATGCTGAGGGGC
ATCTCAGGTGGGCAAAGAAAGCGTGTTACGACTGGTGAGATGCTGGTTGGGCCAGCCAGG
GCGCTCTTCATGGACGAGATCTCAACTGGGCTTGACAGCTCCACTACATTCCAGATAGTG
AATTCGCTTAGGCAAACTGTCCACATCCTCGGTGGCACAGCTGTTATCTCCCTGCTGCAG
CCGGCGCCTGAGACTTACAACTTGTTTGATGATATCATCCTCCTCTCAGACGGTCAGATT
GTGTACCAGGGCCCCCGAGAGGATGTGCTTGAATTCTTCGAGTCCATGGGGTTTAAGTGT
CCTGACAGGAAGGGTGTTGCCGACTTCTTGCAAGAAGTGACTTCTAAGAAAGATCAAAGG
CAGTACTGGGCGAGGCATGACAAGCCCTACAGGTTTGTGACGGTTAAGGAATTTGTGAGT
GCATTCCAGTCGTTCCACACAGGGAGAGCTATAGCAAACGAACTTGCTGTTCCGTTTGAT
AAGAGTAAGAGCCATCCTGCCGCACTGGCTACCACAAGGTACGGTGCTCCTGGCAAGGAG
CTGCTGAAGGCAAATATTGACAGGGAGATTCTCCTCATGAAGAGGAACTCTTTCGTCTAC
ATGTTCAGAACCTTCCAGTTGATGGTGGTGTCACTCATTGCAATGACACTCTTCTTCCGT
ACGAAAATGAAACGTGATTCTGTGACCAGCGGGGGCATCTACATGGGCGCACTCTTCTTT
GGTGTGCTTATGATCATGTTCAATGGTTTCTCAGAGCTTGCGCTCACTGTCTTTAAGTTG
CCTGTTTTCTTCAAGCAGAGGGATCTCCTTTTTTATCCTGCATGGTCGTACACTATACCC
TCATGGATTCTCAAGATCCCAATCACGTTTATTGAGGTTGGTGGGTATGTGTTCTTAACA
TACTACGTCATTGGGTTTGACTCAAACGTGGGCAGCTTCTTCAAGCAGTATTTGCTCATG
TTAGCAATCAATCAGATGGCGGGATCACTTTTCCGATTCATTGGTGGGGCAGCGAGGAAC
ATGATTGTTGCAAATGTCTTTGCATCATTCATGCTGCTAATTTTTATGGTATTGGGTGGA
TTCATTCTAGCAAGAGAGCAAGTGAAGAAATGGTGGATTTGGGGCTACTGGATATCCCCG
ATGATGTACGCCCAGAATGCCATCTCAGTTAATGAACTCATGGGGCACAGCTGGAACAAA
ATTGTGAATAGCTCTGCCTCCAATGAGACCCTTGGTGTGCAAGTCCTCAAGTCCCGTGGA
GTATTCCCTGAAGCCAGGTGGTATTGGATTGGGTTTGGTGCAATGATCGGCTTCACCATC
CTTTTCAATGCTCTCTTCACCCTTGCCCTTACATACCTCAGGCCATATGGAAATTCCCGT
CAGTCAGTATCAGAAGAGGAACTGAAAGAGAAGCGTGCCAATCTGAATGGTGAGATTGTG
GGTGACGTTCACTTGTCATCTGGAAGTACGCGTAGGCCAATGGGAAACGGCACTGAAAAT
GATTCAACAATTGTTGATGATGATACTGAGGTTACTCAAAGGGGGATGGTTCTCCCATTT
ACTCCGCTTTCACTCAGCTTTGACAATGTCAGATATTCTGTTGACATGCCACAGGAAATG
AAAGCACAAGGTGTAGCTGATGACCGGTTGGAGCTCCTCAAAGGTGTTAGTGGTTCATTC
AGGCCAGGGGTGTTGACTGCACTAATGGGTGTCAGTGGTGCTGGCAAGACAACACTGATG
GATGTATTGGCTGGGAGAAAGACAGGTGGGTACATTGAAGGAAGCATCAACATTTCAGGA
TATCCAAAGAAACAAGAGACTTTTGCACGTGTGTCTGGATACTGTGAGCAGAACGATATC
CACTCACCGCAGGTCACAGTCTATGAGTCGCTACTTTTCTCAGCATGGCTCCGTCTTCCT
GAGGATGTAGATTCCAACACTAGAAAGATGTTCATTGAGGAGGTGATGGAGCTTGTGGAG
CTCAAGTCACTGAGAGATGCTTTGGTTGGGCTTCCTGGAGTGAATGGTCTGTCCACTGAA
CAAAGAAAGAGGCTAACAATCGCAGTGGAGCTTGTTGCAAACCCTTCGATTATATTCATG
GACGAGCCAACCTCAGGGCTTGATGCACGAGCAGCTGCAATTGTGATGAGGACAGTGAGG
AACACTGTTAATACTGGCAGAACTGTGGTGTGCACAATTCATCAGCCTAGCATTGACATA
TTTGAAGCATTTGATGAGCTTTTCCTGATGAAGCGAGGTGGTGAAGAGATCTATGCTGGT
CCACTAGGCCATCATTCTTCGGAGCTGATCAAGTATTTTGAGAGTATCCCAGGGGTCAGC
AAAATCAAAGATGGCTATAACCCAGCAACATGGATGTTGGAGGTGACAACAATTGGTCAA
GAGCAGGCACTTGGTGTTGATTTTAGTGATATATACAAGAAGTCTGAACTTTACCAGAGG
AACAAGGCCTTGATAAAGGACCTGAGCCAACCAGCCCCCGATTCAAGTGACCTGTATTTC
CCTACCCAATATTCTCAGTCTTCTTTAACACAATGCATGGCTTGCCTGTGGAAGCAAAAC
CTGTCATACTGGAGGAACCCTCCTTACAATGCCGTTAGGTTCTTTTTCACTACTGTCATT
GCTCTTCTCTTTGGTACCATCTTCTGGGACCTTGGCGGCAAAGTGACGAAGTCACAAGAC
TTGTTCAATGCCATGGGGTCAATGTATGCAGCAGTGCTGTTCATCGGTGTCATGAACTGT
ACATCTGTTCAGCCAGTGGTGGCCGTGGAGCGGACAGTCTTTTACCGTGAAAGGGCTGCC
GGCATGTACTCGGCGTTTCCATATGCATTTGGCCAGGTTGTCATTGAGATCCCATACACA
CTGGTTCAGGCTACTGTATACGGGATCATAGTGTATGCGATGATTGGGTTCGAGTGGACG
GCTGCCAAGTTCTTCTGGTACCTCTTCTTCATGGTCTTCACGCTCCTCTACTTCACATTC
TACGGCATGATGGCGGTCGGCCTGACACCGAACTACCACATTGCCTCGATCGTCTCATCG
GCGTTCTACGCCATCTGGAATCTCTTCTCCGGCTTCGTCATCCCCCGACCTAGAGTCCCA
ATCTGGTGGAGATGGTATTGCTGGGCGTGCCCCGTCGCGTGGACGCTGTACGGCCTCGTC
GTCTCCCAGTTCGGTGACATCGAGACGCCGATGGAAGACGGCACCCCTGTGAAGGTGTTT
GTGGAGAACTACTTCGGCTTCAAGCACAGCTGGTTGGGCTGGGTGGCCACCGTGGTCGCT
GCCTTCGCTTTCCTCTTCGCTTCCTTGTTTGGCTTCGCTATCATGAAGTTCAACTTCCAG
AAGAGATGATGATGACAAGGGATATTACATTCATTGAGTTGCAAACGCTACCTGAAATTT
GTGCATATCATTGGATCTAAAGAATTTTTTTTTGTTGCCATTAGAATATTGTAAATCATA
CCAGCCTTTCCCCCTTATTTTTATAGAAAGATTGTACTACTGTTACACCTAGTAATTTTG
TTATTAGTACCCTTCTTTTTATAGAAAGATGGTACTACTTTTATTTTTAATTTTTATATG
GGGTTGTCTAGTGTTCAGTTGACTGAACTCACATTTTGCTCGATGTAAATGAAGAACAGT
TCTGCTGTTCGTCACTACTATTTTTGTTAATTGTATTGCCCAGTTTTCCTC

CDS

4374 bp

>Os01t0609300-01 PDR-type ABC transporter 9
ATGGACGCGGCGGGGGAGATCCAGAAGGTGGCGAGCATGCGGCTAGGGGGGAGCATGAGG
GGGGACAGCGGGTCGATGTGGAGGAGAGGGGACGACGTGTTCTCGAGGTCGTCGAGGGAG
GAGGACGACGAGGAGGCGCTGCGGTGGGCGGCGCTCGAGAAGCTGCCCACCTACGACCGC
GTGCGCCGCGCCATCCTGCCGCTCGGTGGCGACGACGGCGCCGGGGACGGAGGAGGGAAG
GGCGTCGTGGACGTGCACGGGCTCGGCCCGCGCGAGCGCCGCGCGCTCCTCGAGCGCCTC
GTGCGCGTCGCCGACGAGGACAACGAGAAGTTCCTCCTCAAGCTCAAGGACCGCGTCGAC
CGGGTGGGGATCGACATGCCGACGATCGAGGTGCGGTTCGAGCACCTGGAGGCGGAGGCG
GAGGTCCGCGTCGGCAACAGCGGCCTCCCCACCGTCCTCAACTCCATCACCAACACCCTC
GAGGAAGCCGGCAACGCGCTCGGCATTCTGCCCAACCGGAAGCAGACCATGCCCGTCCTC
CACGACGTCAGCGGCATCATCAAGCCCCGCAGGATGACTCTGCTGTTAGGCCCACCGGGG
TCAGGCAAGACCACCTTGCTGCTCGCGTTGGCCGGAAGGCTCGGCAAAGATCTCAAGGCT
TCAGGAAAAGTGACCTACAACGGGCACGGCATGGAGGAATTCGTGCCGGAGAGGACGGCG
GCTTACATCAGCCAGCACGACCTCCACATCGGAGAGATGACCGTCAGGGAGACACTTGCC
TTCTCGGCACGATGCCAGGGTGTTGGCAGTCGCTTTGATATGTTGACTGAGCTGTCAAGG
CGAGAGAAGGCAGCGAACATTAAGCCTGACGCCGATATCGATGCATTCATGAAGGCGGCT
GCAATGGGAGGACAGGAGGCAAACGTGAACACTGACTATATACTGAAGATATTAGGACTA
GAGATATGCGCTGACACGATGGTTGGGGACGAGATGCTGAGGGGCATCTCAGGTGGGCAA
AGAAAGCGTGTTACGACTGGTGAGATGCTGGTTGGGCCAGCCAGGGCGCTCTTCATGGAC
GAGATCTCAACTGGGCTTGACAGCTCCACTACATTCCAGATAGTGAATTCGCTTAGGCAA
ACTGTCCACATCCTCGGTGGCACAGCTGTTATCTCCCTGCTGCAGCCGGCGCCTGAGACT
TACAACTTGTTTGATGATATCATCCTCCTCTCAGACGGTCAGATTGTGTACCAGGGCCCC
CGAGAGGATGTGCTTGAATTCTTCGAGTCCATGGGGTTTAAGTGTCCTGACAGGAAGGGT
GTTGCCGACTTCTTGCAAGAAGTGACTTCTAAGAAAGATCAAAGGCAGTACTGGGCGAGG
CATGACAAGCCCTACAGGTTTGTGACGGTTAAGGAATTTGTGAGTGCATTCCAGTCGTTC
CACACAGGGAGAGCTATAGCAAACGAACTTGCTGTTCCGTTTGATAAGAGTAAGAGCCAT
CCTGCCGCACTGGCTACCACAAGGTACGGTGCTCCTGGCAAGGAGCTGCTGAAGGCAAAT
ATTGACAGGGAGATTCTCCTCATGAAGAGGAACTCTTTCGTCTACATGTTCAGAACCTTC
CAGTTGATGGTGGTGTCACTCATTGCAATGACACTCTTCTTCCGTACGAAAATGAAACGT
GATTCTGTGACCAGCGGGGGCATCTACATGGGCGCACTCTTCTTTGGTGTGCTTATGATC
ATGTTCAATGGTTTCTCAGAGCTTGCGCTCACTGTCTTTAAGTTGCCTGTTTTCTTCAAG
CAGAGGGATCTCCTTTTTTATCCTGCATGGTCGTACACTATACCCTCATGGATTCTCAAG
ATCCCAATCACGTTTATTGAGGTTGGTGGGTATGTGTTCTTAACATACTACGTCATTGGG
TTTGACTCAAACGTGGGCAGCTTCTTCAAGCAGTATTTGCTCATGTTAGCAATCAATCAG
ATGGCGGGATCACTTTTCCGATTCATTGGTGGGGCAGCGAGGAACATGATTGTTGCAAAT
GTCTTTGCATCATTCATGCTGCTAATTTTTATGGTATTGGGTGGATTCATTCTAGCAAGA
GAGCAAGTGAAGAAATGGTGGATTTGGGGCTACTGGATATCCCCGATGATGTACGCCCAG
AATGCCATCTCAGTTAATGAACTCATGGGGCACAGCTGGAACAAAATTGTGAATAGCTCT
GCCTCCAATGAGACCCTTGGTGTGCAAGTCCTCAAGTCCCGTGGAGTATTCCCTGAAGCC
AGGTGGTATTGGATTGGGTTTGGTGCAATGATCGGCTTCACCATCCTTTTCAATGCTCTC
TTCACCCTTGCCCTTACATACCTCAGGCCATATGGAAATTCCCGTCAGTCAGTATCAGAA
GAGGAACTGAAAGAGAAGCGTGCCAATCTGAATGGTGAGATTGTGGGTGACGTTCACTTG
TCATCTGGAAGTACGCGTAGGCCAATGGGAAACGGCACTGAAAATGATTCAACAATTGTT
GATGATGATACTGAGGTTACTCAAAGGGGGATGGTTCTCCCATTTACTCCGCTTTCACTC
AGCTTTGACAATGTCAGATATTCTGTTGACATGCCACAGGAAATGAAAGCACAAGGTGTA
GCTGATGACCGGTTGGAGCTCCTCAAAGGTGTTAGTGGTTCATTCAGGCCAGGGGTGTTG
ACTGCACTAATGGGTGTCAGTGGTGCTGGCAAGACAACACTGATGGATGTATTGGCTGGG
AGAAAGACAGGTGGGTACATTGAAGGAAGCATCAACATTTCAGGATATCCAAAGAAACAA
GAGACTTTTGCACGTGTGTCTGGATACTGTGAGCAGAACGATATCCACTCACCGCAGGTC
ACAGTCTATGAGTCGCTACTTTTCTCAGCATGGCTCCGTCTTCCTGAGGATGTAGATTCC
AACACTAGAAAGATGTTCATTGAGGAGGTGATGGAGCTTGTGGAGCTCAAGTCACTGAGA
GATGCTTTGGTTGGGCTTCCTGGAGTGAATGGTCTGTCCACTGAACAAAGAAAGAGGCTA
ACAATCGCAGTGGAGCTTGTTGCAAACCCTTCGATTATATTCATGGACGAGCCAACCTCA
GGGCTTGATGCACGAGCAGCTGCAATTGTGATGAGGACAGTGAGGAACACTGTTAATACT
GGCAGAACTGTGGTGTGCACAATTCATCAGCCTAGCATTGACATATTTGAAGCATTTGAT
GAGCTTTTCCTGATGAAGCGAGGTGGTGAAGAGATCTATGCTGGTCCACTAGGCCATCAT
TCTTCGGAGCTGATCAAGTATTTTGAGAGTATCCCAGGGGTCAGCAAAATCAAAGATGGC
TATAACCCAGCAACATGGATGTTGGAGGTGACAACAATTGGTCAAGAGCAGGCACTTGGT
GTTGATTTTAGTGATATATACAAGAAGTCTGAACTTTACCAGAGGAACAAGGCCTTGATA
AAGGACCTGAGCCAACCAGCCCCCGATTCAAGTGACCTGTATTTCCCTACCCAATATTCT
CAGTCTTCTTTAACACAATGCATGGCTTGCCTGTGGAAGCAAAACCTGTCATACTGGAGG
AACCCTCCTTACAATGCCGTTAGGTTCTTTTTCACTACTGTCATTGCTCTTCTCTTTGGT
ACCATCTTCTGGGACCTTGGCGGCAAAGTGACGAAGTCACAAGACTTGTTCAATGCCATG
GGGTCAATGTATGCAGCAGTGCTGTTCATCGGTGTCATGAACTGTACATCTGTTCAGCCA
GTGGTGGCCGTGGAGCGGACAGTCTTTTACCGTGAAAGGGCTGCCGGCATGTACTCGGCG
TTTCCATATGCATTTGGCCAGGTTGTCATTGAGATCCCATACACACTGGTTCAGGCTACT
GTATACGGGATCATAGTGTATGCGATGATTGGGTTCGAGTGGACGGCTGCCAAGTTCTTC
TGGTACCTCTTCTTCATGGTCTTCACGCTCCTCTACTTCACATTCTACGGCATGATGGCG
GTCGGCCTGACACCGAACTACCACATTGCCTCGATCGTCTCATCGGCGTTCTACGCCATC
TGGAATCTCTTCTCCGGCTTCGTCATCCCCCGACCTAGAGTCCCAATCTGGTGGAGATGG
TATTGCTGGGCGTGCCCCGTCGCGTGGACGCTGTACGGCCTCGTCGTCTCCCAGTTCGGT
GACATCGAGACGCCGATGGAAGACGGCACCCCTGTGAAGGTGTTTGTGGAGAACTACTTC
GGCTTCAAGCACAGCTGGTTGGGCTGGGTGGCCACCGTGGTCGCTGCCTTCGCTTTCCTC
TTCGCTTCCTTGTTTGGCTTCGCTATCATGAAGTTCAACTTCCAGAAGAGATGA

Protein

1457 aa

>Os01t0609300-01 PDR-type ABC transporter 9
MDAAGEIQKVASMRLGGSMRGDSGSMWRRGDDVFSRSSREEDDEEALRWAALEKLPTYDR
VRRAILPLGGDDGAGDGGGKGVVDVHGLGPRERRALLERLVRVADEDNEKFLLKLKDRVD
RVGIDMPTIEVRFEHLEAEAEVRVGNSGLPTVLNSITNTLEEAGNALGILPNRKQTMPVL
HDVSGIIKPRRMTLLLGPPGSGKTTLLLALAGRLGKDLKASGKVTYNGHGMEEFVPERTA
AYISQHDLHIGEMTVRETLAFSARCQGVGSRFDMLTELSRREKAANIKPDADIDAFMKAA
AMGGQEANVNTDYILKILGLEICADTMVGDEMLRGISGGQRKRVTTGEMLVGPARALFMD
EISTGLDSSTTFQIVNSLRQTVHILGGTAVISLLQPAPETYNLFDDIILLSDGQIVYQGP
REDVLEFFESMGFKCPDRKGVADFLQEVTSKKDQRQYWARHDKPYRFVTVKEFVSAFQSF
HTGRAIANELAVPFDKSKSHPAALATTRYGAPGKELLKANIDREILLMKRNSFVYMFRTF
QLMVVSLIAMTLFFRTKMKRDSVTSGGIYMGALFFGVLMIMFNGFSELALTVFKLPVFFK
QRDLLFYPAWSYTIPSWILKIPITFIEVGGYVFLTYYVIGFDSNVGSFFKQYLLMLAINQ
MAGSLFRFIGGAARNMIVANVFASFMLLIFMVLGGFILAREQVKKWWIWGYWISPMMYAQ
NAISVNELMGHSWNKIVNSSASNETLGVQVLKSRGVFPEARWYWIGFGAMIGFTILFNAL
FTLALTYLRPYGNSRQSVSEEELKEKRANLNGEIVGDVHLSSGSTRRPMGNGTENDSTIV
DDDTEVTQRGMVLPFTPLSLSFDNVRYSVDMPQEMKAQGVADDRLELLKGVSGSFRPGVL
TALMGVSGAGKTTLMDVLAGRKTGGYIEGSINISGYPKKQETFARVSGYCEQNDIHSPQV
TVYESLLFSAWLRLPEDVDSNTRKMFIEEVMELVELKSLRDALVGLPGVNGLSTEQRKRL
TIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIFEAFD
ELFLMKRGGEEIYAGPLGHHSSELIKYFESIPGVSKIKDGYNPATWMLEVTTIGQEQALG
VDFSDIYKKSELYQRNKALIKDLSQPAPDSSDLYFPTQYSQSSLTQCMACLWKQNLSYWR
NPPYNAVRFFFTTVIALLFGTIFWDLGGKVTKSQDLFNAMGSMYAAVLFIGVMNCTSVQP
VVAVERTVFYRERAAGMYSAFPYAFGQVVIEIPYTLVQATVYGIIVYAMIGFEWTAAKFF
WYLFFMVFTLLYFTFYGMMAVGLTPNYHIASIVSSAFYAIWNLFSGFVIPRPRVPIWWRW
YCWACPVAWTLYGLVVSQFGDIETPMEDGTPVKVFVENYFGFKHSWLGWVATVVAAFAFL
FASLFGFAIMKFNFQKR*

5'UTR

chr01:24081987..24082181 (- strand) : 195 bp

CDS

chr01:24081625..24081986 (- strand) : 362 bp

chr01:24081310..24081519 (- strand) : 210 bp

chr01:24081018..24081102 (- strand) : 85 bp

chr01:24080589..24080748 (- strand) : 160 bp

chr01:24080386..24080462 (- strand) : 77 bp

chr01:24080215..24080268 (- strand) : 54 bp

chr01:24080036..24080126 (- strand) : 91 bp

chr01:24079642..24079943 (- strand) : 302 bp

chr01:24079275..24079556 (- strand) : 282 bp

chr01:24078867..24079183 (- strand) : 317 bp

chr01:24078596..24078756 (- strand) : 161 bp

chr01:24078243..24078509 (- strand) : 267 bp

chr01:24077905..24078155 (- strand) : 251 bp

chr01:24077488..24077820 (- strand) : 333 bp

chr01:24077120..24077410 (- strand) : 291 bp

chr01:24076894..24076977 (- strand) : 84 bp

chr01:24076674..24076807 (- strand) : 134 bp

chr01:24076347..24076574 (- strand) : 228 bp

chr01:24076098..24076269 (- strand) : 172 bp

chr01:24075762..24076016 (- strand) : 255 bp

chr01:24075412..24075669 (- strand) : 258 bp

3'UTR

chr01:24075070..24075411 (- strand) : 342 bp

FASTA

>Os01t0609300-01 class=Sequence position=chr01:24075070..24082181 (- strand)
AAACACACCA CACCCCGCGC CGCGCCGCGC CTTCACTTGC AAAAGCCCGG AAGAAATCCC GGTGCCGCGC CGCGCAGCGC
AGCGCGCAGA CTGCGAGGAA TCGGAATCAC AACAATCACC CACCTCGAGA AGCGCACAAC GGAGAGGGAT TAGAATTGAT
AGCTCTCGGC GAGGAGGTTT TGGTGGTGGT GGGAGATGGA CGCGGCGGGG GAGATCCAGA AGGTGGCGAG CATGCGGCTA
GGGGGGAGCA TGAGGGGGGA CAGCGGGTCG ATGTGGAGGA GAGGGGACGA CGTGTTCTCG AGGTCGTCGA GGGAGGAGGA
CGACGAGGAG GCGCTGCGGT GGGCGGCGCT CGAGAAGCTG CCCACCTACG ACCGCGTGCG CCGCGCCATC CTGCCGCTCG
GTGGCGACGA CGGCGCCGGG GACGGAGGAG GGAAGGGCGT CGTGGACGTG CACGGGCTCG GCCCGCGCGA GCGCCGCGCG
CTCCTCGAGC GCCTCGTGCG CGTCGCCGAC GAGGACAACG AGAAGTTCCT CCTCAAGCTC AAGGACCGCG TCGACCGGTG
CGTGCGTTGC CGCCAGTTCT CGTCTTCGCA TGGCCGCGTT TCTCTGCTTT GCGCCCGCTA GGTGTTTGAT CTAACGACTT
TCGCGCTTGC GCTGTGCGAC AGGGTGGGGA TCGACATGCC GACGATCGAG GTGCGGTTCG AGCACCTGGA GGCGGAGGCG
GAGGTCCGCG TCGGCAACAG CGGCCTCCCC ACCGTCCTCA ACTCCATCAC CAACACCCTC GAGGAAGCCG GCAACGCGCT
CGGCATTCTG CCCAACCGGA AGCAGACCAT GCCCGTCCTC CACGACGTCA GCGGCATCAT CAAGCCCCGC AGGTGAAACA
CCATCCCCCC CCCCCCCCCA ACACACTCCC ACACCCACAT GTTGTTTTCA CCAAAAAAAA AAAGAACATG GATTCTCTTG
TCTTCTGGAG CAATTTTTAT CTCTCGTGTT GGAGACTGGA TTAGTTAAAT CCGGGTCTTT TTTTTTAGAA TTCAATTTCT
TCGCCTTCTT CCCACCTCAC GTTCTTTTCG TTTCTACAGG ATGACTCTGC TGTTAGGCCC ACCGGGGTCA GGCAAGACCA
CCTTGCTGCT CGCGTTGGCC GGAAGGCTCG GCAAAGATCT CAAGGTTCGT TCATCCAAAA CCAACTTCTT GCAAATAATT
CAATTCCAGA TGCCTGTATC CCACTATAGG CGCAGTGTTT CAGCTTCTCA TCTCTACTAG TAGTACTGCT CCAGTACGTA
CTAATACGAA GAATGAGTTA GCCAAAGAAG AAAACACAGA GTAGTACGGG GAGTTCTTTA TTTGGGAAAA AGAAAATAAG
AGATGGATAC TGGAGTACGA ATTATACTGG GCGTTCACAC GTTGTTGATG AGTATAACGA GATGCAATTG CAGGCTTCAG
GAAAAGTGAC CTACAACGGG CACGGCATGG AGGAATTCGT GCCGGAGAGG ACGGCGGCTT ACATCAGCCA GCACGACCTC
CACATCGGAG AGATGACCGT CAGGGAGACA CTTGCCTTCT CGGCACGATG CCAGGGTGTT GGCAGTCGCT TTGGTAAATT
CTACACGATT CTCAGCAGTA GTAGTTGCCT TTTTTACTGC TTGCGGATTA TGCGGGATTG CATGGTTGGA CGGGCATGCT
AAACCAAGTT TTCCTTTTTC CTGTTGTTTT TTTTTTCAGA TATGTTGACT GAGCTGTCAA GGCGAGAGAA GGCAGCGAAC
ATTAAGCCTG ACGCCGATAT CGATGCATTC ATGAAGGTAA AAGGATTTAC GAATCCGAAA TAAAATCAAC AAGATTTTGG
TGTCCTCTTA CTTTTGTTAA TTTTTCTTTT TGAAACGAGG ACTAAGCATT GGTTTTCTGG TCAACTTGTT CAGGCGGCTG
CAATGGGAGG ACAGGAGGCA AACGTGAACA CTGACTATAT ACTGAAGGTG CATCCATCTT TGAGCTAGTG ATTAAATTTT
AGGTAGAATT ACCCAAGAAT TTCTTGTTCA ATGCATTGGA CGTTACTTGT TGCAGATATT AGGACTAGAG ATATGCGCTG
ACACGATGGT TGGGGACGAG ATGCTGAGGG GCATCTCAGG TGGGCAAAGA AAGCGTGTTA CGACTGGTGA GGATTGAACT
CCAACACAAA TTCAGATTGA GACTAACGGC TATGAATGAA CCACGGTGTG ATTATTCCTA TTTTGATGCG TTCTGTAGGT
GAGATGCTGG TTGGGCCAGC CAGGGCGCTC TTCATGGACG AGATCTCAAC TGGGCTTGAC AGCTCCACTA CATTCCAGAT
AGTGAATTCG CTTAGGCAAA CTGTCCACAT CCTCGGTGGC ACAGCTGTTA TCTCCCTGCT GCAGCCGGCG CCTGAGACTT
ACAACTTGTT TGATGATATC ATCCTCCTCT CAGACGGTCA GATTGTGTAC CAGGGCCCCC GAGAGGATGT GCTTGAATTC
TTCGAGTCCA TGGGGTTTAA GTGTCCTGAC AGGAAGGGTG TTGCCGACTT CTTGCAAGAA GTATGTTCAT ATCTCACTGT
TCTTTTTTCT ATGAACACAT AAAGTACAGT TTTTGATAAT ATATGTCTGT GCAAATGCCG AGCAGGTGAC TTCTAAGAAA
GATCAAAGGC AGTACTGGGC GAGGCATGAC AAGCCCTACA GGTTTGTGAC GGTTAAGGAA TTTGTGAGTG CATTCCAGTC
GTTCCACACA GGGAGAGCTA TAGCAAACGA ACTTGCTGTT CCGTTTGATA AGAGTAAGAG CCATCCTGCC GCACTGGCTA
CCACAAGGTA CGGTGCTCCT GGCAAGGAGC TGCTGAAGGC AAATATTGAC AGGGAGATTC TCCTCATGAA GAGGAACTCT
TTCGTCTACA TGTTCAGAAC CTTCCAGGTA ACTGTCATTA CTTCAAACCA AAGGGGTGGT TGCTATGTAA GTAAAGCAAT
AGCAGCATGA CTGACTCCAT GGTGTTATGT CATTACAGTT GATGGTGGTG TCACTCATTG CAATGACACT CTTCTTCCGT
ACGAAAATGA AACGTGATTC TGTGACCAGC GGGGGCATCT ACATGGGCGC ACTCTTCTTT GGTGTGCTTA TGATCATGTT
CAATGGTTTC TCAGAGCTTG CGCTCACTGT CTTTAAGTTG CCTGTTTTCT TCAAGCAGAG GGATCTCCTT TTTTATCCTG
CATGGTCGTA CACTATACCC TCATGGATTC TCAAGATCCC AATCACGTTT ATTGAGGTTG GTGGGTATGT GTTCTTAACA
TACTACGTCA TTGGGTTTGA CTCAAACGTG GGCAGGTGAG ATTTATTGAG ATTATATATT TCACAGGTGT ATAATCAGCT
ATATCTTACT ATAGTGCTGC TCTGCATTGT TCTGAGAGTA TTTGTCTTTT TTTTGTTTAC CCCAGCTTCT TCAAGCAGTA
TTTGCTCATG TTAGCAATCA ATCAGATGGC GGGATCACTT TTCCGATTCA TTGGTGGGGC AGCGAGGAAC ATGATTGTTG
CAAATGTCTT TGCATCATTC ATGCTGCTAA TTTTTATGGT ATTGGGTGGA TTCATTCTAG CAAGAGGTAA ATGCTCACCA
TTATCTGTCT GAGAAGTGCT TGGTTTGCAC TTTTTATCAA AAGCTAAGTG TTCCATTCTG TTCGACTTGC AGAGCAAGTG
AAGAAATGGT GGATTTGGGG CTACTGGATA TCCCCGATGA TGTACGCCCA GAATGCCATC TCAGTTAATG AACTCATGGG
GCACAGCTGG AACAAAATTG TGAATAGCTC TGCCTCCAAT GAGACCCTTG GTGTGCAAGT CCTCAAGTCC CGTGGAGTAT
TCCCTGAAGC CAGGTGGTAT TGGATTGGGT TTGGTGCAAT GATCGGCTTC ACCATCCTTT TCAATGCTCT CTTCACCCTT
GCCCTTACAT ACCTCAGGCG TGAGTATACC TTGAGAACTG ATTTGCTCTT TTTCCTAGAG TTGGCTATAT CCAAACATGA
GAATGATTTC ATCTTGTGAT TTACAGCATA TGGAAATTCC CGTCAGTCAG TATCAGAAGA GGAACTGAAA GAGAAGCGTG
CCAATCTGAA TGGTGAGATT GTGGGTGACG TTCACTTGTC ATCTGGAAGT ACGCGTAGGC CAATGGGAAA CGGCACTGAA
AATGATTCAA CAATTGTTGA TGATGATACT GAGGTTACTC AAAGGGGGAT GGTTCTCCCA TTTACTCCGC TTTCACTCAG
CTTTGACAAT GTCAGATATT CTGTTGACAT GCCACAGGTA AAATATGGAA GAACTCCTAC CAAATCAGGA ATTGATCATT
AGTTTGCATT TTTCTAACTT TCAGCGTGAA ATTAATTTCA GGAAATGAAA GCACAAGGTG TAGCTGATGA CCGGTTGGAG
CTCCTCAAAG GTGTTAGTGG TTCATTCAGG CCAGGGGTGT TGACTGCACT AATGGGTGTC AGTGGTGCTG GCAAGACAAC
ACTGATGGAT GTATTGGCTG GGAGAAAGAC AGGTGGGTAC ATTGAAGGAA GCATCAACAT TTCAGGATAT CCAAAGAAAC
AAGAGACTTT TGCACGTGTG TCTGGATACT GTGAGCAGAA CGATATCCAC TCACCGCAGG TCACAGTCTA TGAGTCGCTA
CTTTTCTCAG CATGGCTCCG TCTTCCTGAG GATGTAGATT CCAACACTAG AAAGGTCCGT CAAACATTTT TTTTTGCTAT
TCCTACCTAT ACTTGATATA GATAGATAGT AGCTTACCTT TGTGTATGCA GATGTTCATT GAGGAGGTGA TGGAGCTTGT
GGAGCTCAAG TCACTGAGAG ATGCTTTGGT TGGGCTTCCT GGAGTGAATG GTCTGTCCAC TGAACAAAGA AAGAGGCTAA
CAATCGCAGT GGAGCTTGTT GCAAACCCTT CGATTATATT CATGGACGAG CCAACCTCAG GGCTTGATGC ACGAGCAGCT
GCAATTGTGA TGAGGACAGT GAGGAACACT GTTAATACTG GCAGAACTGT GGTGTGCACA ATTCATCAGC CTAGCATTGA
CATATTTGAA GCATTTGATG AGGTGAGTGT GATTCTACTT TGGAGATTCG TACCATTTTC TCCTCAGATA TTAGGATACA
TTGCGGAAAG CCCAAAAATC AATTGATTAT GGCTGTGTTT CTAAACTACC TGGATGATTT GACTAATATA TTTTTTGCTT
GCAGCTTTTC CTGATGAAGC GAGGTGGTGA AGAGATCTAT GCTGGTCCAC TAGGCCATCA TTCTTCGGAG CTGATCAAGT
ATTTTGAGGT AAGTGATATT ACACTAATTC TAATATACCT CAATGACATT TCTTCAAAAT TACTGATTCA ATCGCATCTT
TGTGTATCAT CCAGAGTATC CCAGGGGTCA GCAAAATCAA AGATGGCTAT AACCCAGCAA CATGGATGTT GGAGGTGACA
ACAATTGGTC AAGAGCAGGC ACTTGGTGTT GATTTTAGTG ATATATACAA GAAGTCTGAA CTTTACCAGT GAGTAACTTG
CTTTTAATCC TAATTGTTGT TTCATCTTTC TGCAAAGCAA TTTTTTTTTG CAATATGCCA TGTAACACTG ATTGCTACCT
TATTCAGGAG GAACAAGGCC TTGATAAAGG ACCTGAGCCA ACCAGCCCCC GATTCAAGTG ACCTGTATTT CCCTACCCAA
TATTCTCAGT CTTCTTTAAC ACAATGCATG GCTTGCCTGT GGAAGCAAAA CCTGTCATAC TGGAGGAACC CTCCTTACAA
TGCCGTTAGG TTCTTTTTCA CTACTGTCAT TGCTCTTCTC TTTGGTACCA TCTTCTGGGA CCTTGGCGGC AAAGTGTAAG
TAAAATGCCA CTTTCTATAT GCAAAGAGGG TGTACCTTAG AAATCTTATT CATTTCGTGC TTCTTAATCC AGGACGAAGT
CACAAGACTT GTTCAATGCC ATGGGGTCAA TGTATGCAGC AGTGCTGTTC ATCGGTGTCA TGAACTGTAC ATCTGTTCAG
CCAGTGGTGG CCGTGGAGCG GACAGTCTTT TACCGTGAAA GGGCTGCCGG CATGTACTCG GCGTTTCCAT ATGCATTTGG
CCAGGTGAAT GGTCCTCCTG CAACTGACAT TGAGTCCTGG TTGTTGCATC CTTGAGATCC AGATACTGAT TAATTCCTCT
TTCAGGTTGT CATTGAGATC CCATACACAC TGGTTCAGGC TACTGTATAC GGGATCATAG TGTATGCGAT GATTGGGTTC
GAGTGGACGG CTGCCAAGTT CTTCTGGTAC CTCTTCTTCA TGGTCTTCAC GCTCCTCTAC TTCACATTCT ACGGCATGAT
GGCGGTCGGC CTGACACCGA ACTACCACAT TGCCTCGATC GTCTCATCGG CGTTCTACGC CATCTGGAAT CTCTTCTCCG
GCTTCGTCAT CCCCCGACCT GTAAGTTTCG CATTCCCAAT TGCCCCTCAT TCTTCCATAC ACTTCCAACT CCATTGGGTG
CTCATCTCTG TTTGTGCCTG ATGATGTTTC AGAGAGTCCC AATCTGGTGG AGATGGTATT GCTGGGCGTG CCCCGTCGCG
TGGACGCTGT ACGGCCTCGT CGTCTCCCAG TTCGGTGACA TCGAGACGCC GATGGAAGAC GGCACCCCTG TGAAGGTGTT
TGTGGAGAAC TACTTCGGCT TCAAGCACAG CTGGTTGGGC TGGGTGGCCA CCGTGGTCGC TGCCTTCGCT TTCCTCTTCG
CTTCCTTGTT TGGCTTCGCT ATCATGAAGT TCAACTTCCA GAAGAGATGA TGATGACAAG GGATATTACA TTCATTGAGT
TGCAAACGCT ACCTGAAATT TGTGCATATC ATTGGATCTA AAGAATTTTT TTTTGTTGCC ATTAGAATAT TGTAAATCAT
ACCAGCCTTT CCCCCTTATT TTTATAGAAA GATTGTACTA CTGTTACACC TAGTAATTTT GTTATTAGTA CCCTTCTTTT
TATAGAAAGA TGGTACTACT TTTATTTTTA ATTTTTATAT GGGGTTGTCT AGTGTTCAGT TGACTGAACT CACATTTTGC
TCGATGTAAA TGAAGAACAG TTCTGCTGTT CGTCACTACT ATTTTTGTTA ATTGTATTGC CCAGTTTTCC TC

Locus: Os01g0609300

Loading...

Locus: Os01g0609300

Loading...