Os01t0609300-02

Locus

Os01g0609300

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PDR9

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 9

Oryzabase Gene Symbol Synonym(s)

OsPDR9, ospdr9, OsPDR3, PDR3, OsABCG36/OsPDR9, OsABCG36

Oryzabase Gene Name Synonym(s)

pleiotropic drug resistance 9, PDR-type ABC transporter 9, sativa pleiotropic drug resistance 3, pleiotropic drug resistance 3, Pleiotropic drug resistance protein 3

Transcript Evidence

AK058981 (DDBJ, Best hit)

Protein Evidence

A2ZV99 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

ABC-2 type transporter (IPR013525)

Full-length cDNA

001-020-D12 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0609300-02)

RiceXPro (AK058981)

Others

Oryzabase (8341)

KEGG (Os01t0609300-02)

Transcript

1547 bp

>Os01t0609300-02 Hypothetical conserved gene.
AAAGAAAGAGGCTAACAATCGCAGTGGAGCTTGTTGCAAACCCTTCGATTATATTCATGG
ACGAGCCAACCTCAGGGCTTGATGCACGAGCAGCTGCAATTGTGATGAGGACAGTGAGGA
ACACTGTTAATACTGGCAGAACTGTGGTGTGCACAATTCATCAGCCTAGCATTGACATAT
TTGAAGCATTTGATGAGCTTTTCCTGATGAAGCGAGGTGGTGAAGAGATCTATGCTGGTC
CACTAGGCCATCATTCTTCGGAGCTGATCAAGTATTTTGAGAGTATCCCAGGGGTCAGCA
AAATCAAAGATGGCTATAACCCAGCAACATGGATGTTGGAGGTGACAACAATTGGTCAAG
AGCAGGCACTTGGTGTTGATTTTAGTGATATATACAAGAAGTCTGAACTTTACCAGAGGA
ACAAGGCCTTGATAAAGGACCTGAGCCAACCAGCCCCCGATTCAAGTGACCTGTATTTCC
CTACCCAATATTCTCAGTCTTCTTTAACACAATGCATGGCTTGCCTGTGGAAGCAAAACC
TGTCATACTGGAGGAACCCTCCTTACAATGCCGTTAGGTTCTTTTTCACTACTGTCATTG
CTCTTCTCTTTGGTACCATCTTCTGGGACCTTGGCGGCAAAGTGACGAAGTCACAAGACT
TGTTCAATGCCATGGGGTCAATGTATGCAGCAGTGCTGTTCATCGGTGTCATGAACTGTA
CATCTGTTCAGCCAGTGGTGGCCGTGGAGCGGACAGTCTTTTACCGTGAAAGGGCTGCCG
GCATGTACTCGGCGTTTCCATATGCATTTGGCCAGGTTGTCATTGAGATCCCATACACAC
TGGTTCAGGCTACTGTATACGGGATCATAGTGTATGCGATGATTGGGTTCGAGTGGACGG
CTGCCAAGTTCTTCTGGTACCTCTTCTTCATGGTCTTCACGCTCCTCTACTTCACATTCT
ACGGCATGATGGCGGTCGGCCTGACACCGAACTACCACATTGCCTCGATCGTCTCATCGG
CGTTCTACGCCATCTGGAATCTCTTCTCCGGCTTCGTCATCCCCCGACCTAGAGTCCCAA
TCTGGTGGAGATGGTATTGCTGGGCGTGCCCCGTCGCGTGGACGCTGTACGGCCTCGTCG
TCTCCCAGTTCGGTGACATCGAGACGCCGATGGAAGACGGCACCCCTGTGAAGGTGTTTG
TGGAGAACTACTTCGGCTTCAAGCACAGCTGGTTGGGCTGGGTGGCCACCGTGGTCGCTG
CCTTCGCTTTCCTCTTCGCTTCCTTGTTTGGCTTCGCTATCATGAAGTTCAACTTCCAGA
AGAGATGATGATGACAAGGGATATTACATTCATTGAGTTGCAAACGCTACCTGAAATTTG
TGCATATCATTGGATCTAAAGAATTTTTTTTTGTTGCCATTAGAATATTGTAAATCATAC
CAGCCTTTCCCCCTTATTTTTATAGAAAGATTGTACTACTGTTACACCTAGTAATTTTGT
TATTAGTACCCTTCTTTTTATAGAAAGATGGTACTACTTTTATTTTT

CDS

1326 bp

>Os01t0609300-02 Hypothetical conserved gene.
AGAAAGAGGCTAACAATCGCAGTGGAGCTTGTTGCAAACCCTTCGATTATATTCATGGAC
GAGCCAACCTCAGGGCTTGATGCACGAGCAGCTGCAATTGTGATGAGGACAGTGAGGAAC
ACTGTTAATACTGGCAGAACTGTGGTGTGCACAATTCATCAGCCTAGCATTGACATATTT
GAAGCATTTGATGAGCTTTTCCTGATGAAGCGAGGTGGTGAAGAGATCTATGCTGGTCCA
CTAGGCCATCATTCTTCGGAGCTGATCAAGTATTTTGAGAGTATCCCAGGGGTCAGCAAA
ATCAAAGATGGCTATAACCCAGCAACATGGATGTTGGAGGTGACAACAATTGGTCAAGAG
CAGGCACTTGGTGTTGATTTTAGTGATATATACAAGAAGTCTGAACTTTACCAGAGGAAC
AAGGCCTTGATAAAGGACCTGAGCCAACCAGCCCCCGATTCAAGTGACCTGTATTTCCCT
ACCCAATATTCTCAGTCTTCTTTAACACAATGCATGGCTTGCCTGTGGAAGCAAAACCTG
TCATACTGGAGGAACCCTCCTTACAATGCCGTTAGGTTCTTTTTCACTACTGTCATTGCT
CTTCTCTTTGGTACCATCTTCTGGGACCTTGGCGGCAAAGTGACGAAGTCACAAGACTTG
TTCAATGCCATGGGGTCAATGTATGCAGCAGTGCTGTTCATCGGTGTCATGAACTGTACA
TCTGTTCAGCCAGTGGTGGCCGTGGAGCGGACAGTCTTTTACCGTGAAAGGGCTGCCGGC
ATGTACTCGGCGTTTCCATATGCATTTGGCCAGGTTGTCATTGAGATCCCATACACACTG
GTTCAGGCTACTGTATACGGGATCATAGTGTATGCGATGATTGGGTTCGAGTGGACGGCT
GCCAAGTTCTTCTGGTACCTCTTCTTCATGGTCTTCACGCTCCTCTACTTCACATTCTAC
GGCATGATGGCGGTCGGCCTGACACCGAACTACCACATTGCCTCGATCGTCTCATCGGCG
TTCTACGCCATCTGGAATCTCTTCTCCGGCTTCGTCATCCCCCGACCTAGAGTCCCAATC
TGGTGGAGATGGTATTGCTGGGCGTGCCCCGTCGCGTGGACGCTGTACGGCCTCGTCGTC
TCCCAGTTCGGTGACATCGAGACGCCGATGGAAGACGGCACCCCTGTGAAGGTGTTTGTG
GAGAACTACTTCGGCTTCAAGCACAGCTGGTTGGGCTGGGTGGCCACCGTGGTCGCTGCC
TTCGCTTTCCTCTTCGCTTCCTTGTTTGGCTTCGCTATCATGAAGTTCAACTTCCAGAAG
AGATGA

Protein

441 aa

>Os01t0609300-02 Hypothetical conserved gene.
RKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIF
EAFDELFLMKRGGEEIYAGPLGHHSSELIKYFESIPGVSKIKDGYNPATWMLEVTTIGQE
QALGVDFSDIYKKSELYQRNKALIKDLSQPAPDSSDLYFPTQYSQSSLTQCMACLWKQNL
SYWRNPPYNAVRFFFTTVIALLFGTIFWDLGGKVTKSQDLFNAMGSMYAAVLFIGVMNCT
SVQPVVAVERTVFYRERAAGMYSAFPYAFGQVVIEIPYTLVQATVYGIIVYAMIGFEWTA
AKFFWYLFFMVFTLLYFTFYGMMAVGLTPNYHIASIVSSAFYAIWNLFSGFVIPRPRVPI
WWRWYCWACPVAWTLYGLVVSQFGDIETPMEDGTPVKVFVENYFGFKHSWLGWVATVVAA
FAFLFASLFGFAIMKFNFQKR*

5'UTR

chr01:24077315..24077316 (- strand) : 2 bp

CDS

chr01:24077120..24077314 (- strand) : 195 bp

chr01:24076894..24076977 (- strand) : 84 bp

chr01:24076674..24076807 (- strand) : 134 bp

chr01:24076347..24076574 (- strand) : 228 bp

chr01:24076098..24076269 (- strand) : 172 bp

chr01:24075762..24076016 (- strand) : 255 bp

chr01:24075412..24075669 (- strand) : 258 bp

3'UTR

chr01:24075193..24075411 (- strand) : 219 bp

FASTA

>Os01t0609300-02 class=Sequence position=chr01:24075193..24077316 (- strand)
AAAGAAAGAG GCTAACAATC GCAGTGGAGC TTGTTGCAAA CCCTTCGATT ATATTCATGG ACGAGCCAAC CTCAGGGCTT
GATGCACGAG CAGCTGCAAT TGTGATGAGG ACAGTGAGGA ACACTGTTAA TACTGGCAGA ACTGTGGTGT GCACAATTCA
TCAGCCTAGC ATTGACATAT TTGAAGCATT TGATGAGGTG AGTGTGATTC TACTTTGGAG ATTCGTACCA TTTTCTCCTC
AGATATTAGG ATACATTGCG GAAAGCCCAA AAATCAATTG ATTATGGCTG TGTTTCTAAA CTACCTGGAT GATTTGACTA
ATATATTTTT TGCTTGCAGC TTTTCCTGAT GAAGCGAGGT GGTGAAGAGA TCTATGCTGG TCCACTAGGC CATCATTCTT
CGGAGCTGAT CAAGTATTTT GAGGTAAGTG ATATTACACT AATTCTAATA TACCTCAATG ACATTTCTTC AAAATTACTG
ATTCAATCGC ATCTTTGTGT ATCATCCAGA GTATCCCAGG GGTCAGCAAA ATCAAAGATG GCTATAACCC AGCAACATGG
ATGTTGGAGG TGACAACAAT TGGTCAAGAG CAGGCACTTG GTGTTGATTT TAGTGATATA TACAAGAAGT CTGAACTTTA
CCAGTGAGTA ACTTGCTTTT AATCCTAATT GTTGTTTCAT CTTTCTGCAA AGCAATTTTT TTTTGCAATA TGCCATGTAA
CACTGATTGC TACCTTATTC AGGAGGAACA AGGCCTTGAT AAAGGACCTG AGCCAACCAG CCCCCGATTC AAGTGACCTG
TATTTCCCTA CCCAATATTC TCAGTCTTCT TTAACACAAT GCATGGCTTG CCTGTGGAAG CAAAACCTGT CATACTGGAG
GAACCCTCCT TACAATGCCG TTAGGTTCTT TTTCACTACT GTCATTGCTC TTCTCTTTGG TACCATCTTC TGGGACCTTG
GCGGCAAAGT GTAAGTAAAA TGCCACTTTC TATATGCAAA GAGGGTGTAC CTTAGAAATC TTATTCATTT CGTGCTTCTT
AATCCAGGAC GAAGTCACAA GACTTGTTCA ATGCCATGGG GTCAATGTAT GCAGCAGTGC TGTTCATCGG TGTCATGAAC
TGTACATCTG TTCAGCCAGT GGTGGCCGTG GAGCGGACAG TCTTTTACCG TGAAAGGGCT GCCGGCATGT ACTCGGCGTT
TCCATATGCA TTTGGCCAGG TGAATGGTCC TCCTGCAACT GACATTGAGT CCTGGTTGTT GCATCCTTGA GATCCAGATA
CTGATTAATT CCTCTTTCAG GTTGTCATTG AGATCCCATA CACACTGGTT CAGGCTACTG TATACGGGAT CATAGTGTAT
GCGATGATTG GGTTCGAGTG GACGGCTGCC AAGTTCTTCT GGTACCTCTT CTTCATGGTC TTCACGCTCC TCTACTTCAC
ATTCTACGGC ATGATGGCGG TCGGCCTGAC ACCGAACTAC CACATTGCCT CGATCGTCTC ATCGGCGTTC TACGCCATCT
GGAATCTCTT CTCCGGCTTC GTCATCCCCC GACCTGTAAG TTTCGCATTC CCAATTGCCC CTCATTCTTC CATACACTTC
CAACTCCATT GGGTGCTCAT CTCTGTTTGT GCCTGATGAT GTTTCAGAGA GTCCCAATCT GGTGGAGATG GTATTGCTGG
GCGTGCCCCG TCGCGTGGAC GCTGTACGGC CTCGTCGTCT CCCAGTTCGG TGACATCGAG ACGCCGATGG AAGACGGCAC
CCCTGTGAAG GTGTTTGTGG AGAACTACTT CGGCTTCAAG CACAGCTGGT TGGGCTGGGT GGCCACCGTG GTCGCTGCCT
TCGCTTTCCT CTTCGCTTCC TTGTTTGGCT TCGCTATCAT GAAGTTCAAC TTCCAGAAGA GATGATGATG ACAAGGGATA
TTACATTCAT TGAGTTGCAA ACGCTACCTG AAATTTGTGC ATATCATTGG ATCTAAAGAA TTTTTTTTTG TTGCCATTAG
AATATTGTAA ATCATACCAG CCTTTCCCCC TTATTTTTAT AGAAAGATTG TACTACTGTT ACACCTAGTA ATTTTGTTAT
TAGTACCCTT CTTTTTATAG AAAGATGGTA CTACTTTTAT TTTT

Locus: Os01g0609300

Loading...

Locus: Os01g0609300

Loading...