Os01t0609900-01

Locus

Os01g0609900

Description

Similar to Pleiotropic drug resistance protein 4.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PDR8

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 8

Oryzabase Gene Symbol Synonym(s)

OsPDR8, PDR4, P0410E03.16, OsABCG37, OsPDR4

Oryzabase Gene Name Synonym(s)

sativa pleiotropic drug resistance 8, Pleiotropic drug resistance protein 4, ABC transporter superfamily ABCG subgroup member 37, pleiotropic drug resistance 4

Transcript Evidence

AK121722 (DDBJ, Best hit)

Protein Evidence

Q8GU89 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Functional domain (InterPro)

ABC transporter-like (IPR003439)

Full-length cDNA

J033081K15 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0609900-01)

RiceXPro (AK121722)

Others

Oryzabase (8340)

KEGG (Os01t0609900-01)

Transcript

4826 bp

>Os01t0609900-01 Similar to Pleiotropic drug resistance protein 4.
AAACTTGTAGCTTAGCCTTGCAAGGCCAAGCAGGCAGAGGCAGAAGAGCACAACTCCCCC
CAAAGGAGGAGTTTGCTCGATCGATCACCAAGAACATCGAGAGGAAGAGGAAGAGGAAGC
AGGATGGATCGGGAGGTGCACAGgatggcgagcctgaggagggaagggtcgatgtggagg
agcggcggcgacgtgttctcgcggtcgtcgtcgcggttccaggacgaggacgacgacgag
gaggcgctgcggtgggcggcgctggagcggctgccgacgtacgaccgcgtgcggcggggg
atcctggcggtgtcgtcggaggacggcggcgccggcggggagaaggtggaggtggacgtg
gggaggctgggggcgagggagagcagggcgctgatcgagcggctggtccgcgccgccgac
gaCGACCACGAGCGGTTCCTCCTCAAGCTCCGGGAGCGGATGGACCGCGTGGGGATCGAC
TACCCCACCATCGAGGTGCGGTTCGAGAACCTCGAGGTGGAGGCCGACGTCCACGTCGGC
AACCGCGGCCTCCCCACCCTCCTCAACTCCGTCACCAACACCGTCGAGGCAATCGGGAAC
GCGCTCCACATCCTCCCCAACAAGAAGCAGCCGATGACCGTCCTCCATGACGTCAGCGGG
ATCATCAAGCCCCGGAGGATGACCTTGCTGCTGGGACCTCCTGGCTCGGGCAAGACCACG
TTGCTCCTGGCGTTGGCAGGGAAGCTCGACAAGGACCTCAAGGTCTCGGGGAAGGTGACC
TACAATGGACACGGGATGCACGAGTTCGTCCCGGAAAGGACCGCGGCGTACATCAGCCAG
CATGATCTCCACATCGGGGAGATGACCGTGAGGGAGACATTGGCCTTCTCGGCGCGGTGC
CAAGGCGTTGGCACTAGATATGAAATGCTGACTGAGTTGGCAAGAAGGGAAAAGGCAGCA
AACATCAAGCCAGATCATGATATTGATATCTACATGAAGGCCTCAGCTATGGGAGGACAA
GAATCTAGTGTTGTTACGGACTACATATTGAAGATATTAGGATTGGATATTTGTGCTGAT
ACGGTAGTAGGAAATGAGATGTTAAGGGGTATATCTGGTGGACAACGGAAGCGTGTCACA
ACAGGTATGACTAACAGTCTTTAGCAAGATGGGGGTTGTTCTTTAAAGAAAAACTCTAAC
TGTCCTATATGTTCACAGGTGAAATGCTTGTTGGTCCAGCAAGAGCTTTGTTCATGGATG
AGATATCCACTGGACTGGACAGCTCAACCACGTACCAGATCGTGAATTCCCTTAGGCAGA
CTATCCACATCCTTGGCGGAACTGCTGTCATCTCATTGCTCCAGCCAGCACCTGAAACAT
ACAACTTGTTTGATGACATTATACTCCTCTCTGACGGGCAGGTTGTGTACCAGGGTCCCC
GTGAACATGTGCTTGAGTTCTTTGAGTTCATGGGCTTCAGATGCCCTGCCAGAAAGGGTG
TTGCTGATTTCTTGCAGGAGGTGACATCAAGGAAAGATCAGGGGCAGTACTGGTGTAGGC
GTGACAGACCATACCGTTTTGTGCCAGTGAAGCAATTCGCAGATGCGTTCCGTTCCTTCC
ATGTGGGCCGATCCATACAGAATGAGCTTTCTGAGCCATTTGATAGGACCAGGAGCCACC
CTGCTGCTCTGGCTACTTCAAAGTATGGTGTCAGCAGGAAGGAGTTGCTCAAAGCCACTA
TCGATAGAGAGCTTCTTCTCATGAAGAGGAATGCATTTATGTACATTTTTAAAGCTGTTA
ATCTAACTCTAATGGCATTGATCGTGATGACCACATTTTTCCGTACCAGCATGCGACATG
ATAGAGATTATGGAATGATCTATCTGGGGGCATTGTACTTTGCTCTTGACACAGTCATGT
TTAATGGTTTCGCAGAGCTTGCCATGACTGTCATGAAACTACCTGTTTTCTTCAAGCAAA
GGGATCTTCTCTTCTTTCCTGCATGGGCCTACACCATACCATCATGGATTCTTCAGATTC
CTATCACATTTCTCGAAGTTGGTGTTTATGTTTTCATAACATACTATGTCATTGGATTTG
ATCCCAGTGTAAGCAGGTTCTTCAAGCAGTATCTGCTGCTACTTGCACTCAACCAGATGT
CATCTGCACTATTCCGCTTCATTGCTGGAATCGGAAGAGACATGGTTGTGTCTCACACAT
TTGGACCCTTATCACTGTTGGCTTTTGCAGCATTGGGTGGCTTTATCCTTGCAAGACCTG
ACGTGAAGAAATGGTGGATTTGGGGTTACTGGATATCCCCGCTATCGTATGCACAAAATG
CTATTTCGACAAATGAATTTTTGGGTCACAGTTGGAGCCAAATACTTCCTGGAGAAAATG
TGACCTTGGGAGTTAGTGTACTAAAATCTCGTGGTATCTTTACTGAAGCTAAGTGGTACT
GGATTGGACTTGGTGCTTTGCTTGGATACACTCTCCTCTTTAACCTGCTCTACACTGTAG
CTCTTTCAGTTTTGAGTCCATTCACTGACTCTCATGCATCAATGTCTGAGGACGCATTGA
AAGAGAAGCATGCCAACTTAACCGGTGAAGTTGTAGAGGGACAGAAGGACACTAAATCTA
GGAAGCAGGAATTGGAATTGTCCCATATTGCTGACCAAAACTCTGGAATTAACAGCGCTG
ATTCTAGCGCAAGCAGGAAGGGAATGGTGCTCCCATTTGCACCACTATCTATTAGTTTTA
ACGACGTAAGATACTCAGTGGACATGCCAGAGGCAATGAAAGCACAAGGCATAACAGAAG
ACCGTTTGTTGCTTCTAAAGGGTGTTAGTGGTTCTTTCAGGCCAGGTGTACTTACTGCAT
TGATGGGTGTAAGTGGTGCCGGGAAGACAACACTGATGGATGTTTTAGCAGGGAGAAAAA
CTGGAGGATACATAGAGGGAGATATTAGAATATCTGGCTATCCAAAGAAGCAAGAGACCT
TTGCACGTATATCAGGATATTGTGAGCAAAATGACATCCATTCTCCCCATGTGACAGTAT
ATGAATCACTTGTGTTCTCTGCATGGCTGCGGCTACCCTCGGAGGTTGATTCAGAAGCAA
GAAAGATGTTTATTGAGGAGGTCATGGATCTTGTAGAGCTCACATCTCTGAGGGGAGCAC
TTGTTGGGCTTCCTGGAGTGAGCGGCCTGTCAACTGAGCAACGCAAGAGACTTACTATTG
CTGTGGAGCTTGTTGCAAACCCTTCAATTATTTTTATGGATGAGCCAACATCTGGTCTTG
ATGCTCGGGCAGCTGCGATTGTGATGAGGACCGTAAGGAACACCGTTAACACTGGCAGGA
CTGTTGTTTGTACCATTCACCAGCCAAGTATTGACATCTTTGAAGCATTTGATGAGCTTT
TCCTAATGAAGAGAGGAGGTGAAGAGATATATGTTGGTCCAGTGGGCCAGAATTCCTCAA
AACTGATTGAGTACTTTGAGGGAATTGATGGCGTTAGTAGGATAAAAGATGGATATAATC
CAGCAACATGGATGTTGGAAGTGACCTCTTCAGCCCAGGAGGAGATGCTCGGTGTTGATT
TTAGTGAAATCTACAGGCAGTCAGAGCTATATCAAAGGAACAAGGAACTTATTGAGGAGC
TAAGCACACCACCTCCTGGCTCTACTGATCTCAACTTCCCTACGCAGTACTCTAGATCGT
TCATTACACAGTGCCTAGCTTGCTTGTGGAAGCAGAATTGGTCATATTGGAGGAATCCAT
CCTACACTGCAGTGAGATTACTCTTCACTATCGTCATTGCCCTAATGTTTGGAACAATGT
TCTGGAACCTTGGAACGAGAACTAAAAAACAACAGGATCTATTCAATGCCATGGGATCAA
TGTATGCTGCAGTTCTCTACATTGGAGTGCAAAACTCTGGTTCTGTTCAACCAGTGGTGG
TGGTGGAGCGAACAGTCTTTTACCGAGAAAGAGCAGCTGGCATGTATTCAGCTTTCCCGT
ATGCATTTGGACAGGTTGCAATTGAGTTACCATACATCATGGTTCAGACTCTGATATATG
GCGTGCTGGTATACTCAATGATTGGATTTGAGTGGACTGTTGCCAAGTTCTTGTGGTACT
TGTTCTTCATGTACTTCACACTGCTATATTTCACATTTTACGGAATGATGGCGGTAGGGT
TGACACCAAATGAGAGCATAGCAGCAATCATCTCGTCCGCTTTCTACAATGTGTGGAACC
TCTTCTCAGGATATCTGATCCCTCGACCGAAAATCCCTGTTTGGTGGAGGTGGTACTGTT
GGATTTGCCCGGTTGCATGGACTTTGTATGGATTAGTTGCTTCCCAGTTTGGTGATATCC
AACATGTGCTCGAAGGCGACACCAGAACTGTTGCACAGTTTGTCACTGATTACTTTGGCT
TCCATCATAACTTCCTGTGGGTGGTGGCCGTGGTGCACGTCGTCTTCGCCGTGACCTTCG
CCTTCCTCTTCAGTTTTGCGATCATGAAGTTCAACTTCCAGAGGAGATGAGAAAGTGATC
ATTCTTTTTTGCATTCGTTCTATTGTACTACTGAATAGCTATTAGCTATCCTGTAAATGG
TATAGAGATCATCTTCTAGTATTTCATTATTTCAAGCATGTAAAAATTCGGACATCTAGT
AGGATTCTCTAGGAAAAAGAACCCTTGTTGAGCTTCCTGCCTCTTGACCAGCTCTAGCTG
ATAAATGTCGGATGCAGATGAATGTAAAGTATGGCCTTCAATGTTTTCATTTTTGTCGAA
TTAATGAAAGCAGAAAATTTGTTGAT

CDS

1041 bp

>Os01t0609900-01 Similar to Pleiotropic drug resistance protein 4.
ATGGATCGGGAGGTGCACAGgatggcgagcctgaggagggaagggtcgatgtggaggagc
ggcggcgacgtgttctcgcggtcgtcgtcgcggttccaggacgaggacgacgacgaggag
gcgctgcggtgggcggcgctggagcggctgccgacgtacgaccgcgtgcggcgggggatc
ctggcggtgtcgtcggaggacggcggcgccggcggggagaaggtggaggtggacgtgggg
aggctgggggcgagggagagcagggcgctgatcgagcggctggtccgcgccgccgacgaC
GACCACGAGCGGTTCCTCCTCAAGCTCCGGGAGCGGATGGACCGCGTGGGGATCGACTAC
CCCACCATCGAGGTGCGGTTCGAGAACCTCGAGGTGGAGGCCGACGTCCACGTCGGCAAC
CGCGGCCTCCCCACCCTCCTCAACTCCGTCACCAACACCGTCGAGGCAATCGGGAACGCG
CTCCACATCCTCCCCAACAAGAAGCAGCCGATGACCGTCCTCCATGACGTCAGCGGGATC
ATCAAGCCCCGGAGGATGACCTTGCTGCTGGGACCTCCTGGCTCGGGCAAGACCACGTTG
CTCCTGGCGTTGGCAGGGAAGCTCGACAAGGACCTCAAGGTCTCGGGGAAGGTGACCTAC
AATGGACACGGGATGCACGAGTTCGTCCCGGAAAGGACCGCGGCGTACATCAGCCAGCAT
GATCTCCACATCGGGGAGATGACCGTGAGGGAGACATTGGCCTTCTCGGCGCGGTGCCAA
GGCGTTGGCACTAGATATGAAATGCTGACTGAGTTGGCAAGAAGGGAAAAGGCAGCAAAC
ATCAAGCCAGATCATGATATTGATATCTACATGAAGGCCTCAGCTATGGGAGGACAAGAA
TCTAGTGTTGTTACGGACTACATATTGAAGATATTAGGATTGGATATTTGTGCTGATACG
GTAGTAGGAAATGAGATGTTAAGGGGTATATCTGGTGGACAACGGAAGCGTGTCACAACA
GGTATGACTAACAGTCTTTAG

Protein

346 aa

>Os01t0609900-01 Similar to Pleiotropic drug resistance protein 4.
MDREVHRMASLRREGSMWRSGGDVFSRSSSRFQDEDDDEEALRWAALERLPTYDRVRRGI
LAVSSEDGGAGGEKVEVDVGRLGARESRALIERLVRAADDDHERFLLKLRERMDRVGIDY
PTIEVRFENLEVEADVHVGNRGLPTLLNSVTNTVEAIGNALHILPNKKQPMTVLHDVSGI
IKPRRMTLLLGPPGSGKTTLLLALAGKLDKDLKVSGKVTYNGHGMHEFVPERTAAYISQH
DLHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAANIKPDHDIDIYMKASAMGGQE
SSVVTDYILKILGLDICADTVVGNEMLRGISGGQRKRVTTGMTNSL*

5'UTR

chr01:24115165..24115287 (- strand) : 123 bp

CDS

chr01:24114700..24115164 (- strand) : 465 bp

chr01:24113211..24113299 (- strand) : 89 bp

chr01:24112852..24113096 (- strand) : 245 bp

chr01:24112674..24112750 (- strand) : 77 bp

chr01:24112455..24112508 (- strand) : 54 bp

chr01:24112236..24112346 (- strand) : 111 bp

3'UTR

chr01:24111880..24112235 (- strand) : 356 bp

chr01:24111503..24111784 (- strand) : 282 bp

chr01:24111105..24111418 (- strand) : 314 bp

chr01:24110768..24110928 (- strand) : 161 bp

chr01:24110563..24110666 (- strand) : 104 bp

chr01:24110324..24110480 (- strand) : 157 bp

chr01:24109970..24110223 (- strand) : 254 bp

chr01:24109549..24109881 (- strand) : 333 bp

chr01:24109162..24109452 (- strand) : 291 bp

chr01:24108990..24109073 (- strand) : 84 bp

chr01:24108753..24108886 (- strand) : 134 bp

chr01:24108424..24108651 (- strand) : 228 bp

chr01:24108169..24108340 (- strand) : 172 bp

chr01:24107720..24107974 (- strand) : 255 bp

chr01:24107088..24107624 (- strand) : 537 bp

FASTA

>Os01t0609900-01 class=Sequence position=chr01:24107088..24115287 (- strand)
AAACTTGTAG CTTAGCCTTG CAAGGCCAAG CAGGCAGAGG CAGAAGAGCA CAACTCCCCC CAAAGGAGGA GTTTGCTCGA
TCGATCACCA AGAACATCGA GAGGAAGAGG AAGAGGAAGC AGGATGGATC GGGAGGTGCA CAGgatggcg agcctgagga
gggaagggtc gatgtggagg agcggcggcg acgtgttctc gcggtcgtcg tcgcggttcc aggacgagga cgacgacgag
gaggcgctgc ggtgggcggc gctggagcgg ctgccgacgt acgaccgcgt gcggcggggg atcctggcgg tgtcgtcgga
ggacggcggc gccggcgggg agaaggtgga ggtggacgtg gggaggctgg gggcgaggga gagcagggcg ctgatcgagc
ggctggtccg cgccgccgac gaCGACCACG AGCGGTTCCT CCTCAAGCTC CGGGAGCGGA TGGACCGCGT GGGGATCGAC
TACCCCACCA TCGAGGTGCG GTTCGAGAAC CTCGAGGTGG AGGCCGACGT CCACGTCGGC AACCGCGGCC TCCCCACCCT
CCTCAACTCC GTCACCAACA CCGTCGAGGT ACGTGCGTAC GTAACTACTA CCGCGTGAAT TTTCCTCGTG GTGGTTTGAT
GGCGCGGCGC GATGCCGCGA TGTAACGTGA GGAGAAGGCA AACGCTTTTT GTTTTTGAGA TGATGAAACG ATTCGAGAGA
gaggccgagt ttagtttcaa attttttctt caaattttta atttttttca ttatattaaa attttcttac atacaaactt
ttaacttttt cgttatatca ttccaatttt aatcaaattt tcaattttag cgtgggctaa acacaccAGA GGTAGGTGAG
CGTGGCCACG GTCTCCGCGG CGTCGCGCGC GGACGCCGCT AGCTTTGGCT ACATCCGGTC AAACGGTGGG ACGGACAGAG
CGTGCACTCG GTGGCGCCGG CGCCGGCGCC ACGGCGCCAC CGAACGCAGC ACGCACGTGT TGGGTTGGGT TACTGTTGCT
ACGCTCAGCT TTAGTTTTGT GCCCTGGGCT ACCCGACGAG TTGGCCCAAT TGCCGGGGAG ACTTGGCACT TGTGCAAGTG
CAGGTTAATT ACAAGCAAGC AACGTGTACT CTTGTCGTGT GAGGTGTGTT TGCGTACGGC ACCGTTCGAT TCTGGGTGAT
GAAGATTAAC TAGAGGCACA TAAAATAAGA AAATTATTAA CATATGATCA ACTAAGTTTT AATTATTTTA AACCGATAAA
ATAGATTTAT TTGTTATTTT AAAATATTTT TTATATAAAA TGTTTTTATA CGAGACGTAC CCGTTTTGAA AATCTATATC
TTAAATTAAT AAAAAAACCA TTATTGATTA TTTTTAAAGG AATAGTTAAA TCCTGAAAAA AAAGTTGTGG ATGAACAGAT
CAAATAGTAA AATTAAGATT TTTTTTGGGA TAGGAAAAGG TGAAGGAAAA AAAAAACGTT TTCTTGAAAA GAAGGGAAAC
AAGGAGCAGA TATAGTGGAG CCCACTAAGC TAAAAGCCCC CATGGCGGGC CCGGCCTGCA GGGAGACTCT TTCTGGTTCG
GGTTCAACCA AACTAGTTGA CCGTTTCCAC TATCCACCAA CCTCCCACCC TCTCCCCGCC ACCTCCCACC TTACCGCCGC
CGCCGCCGTC GCTGGCGGCG CCGCGGCGGC GAGACGGCGA CCGCTTTTCC TACCTCGAAT GAGTTCTCAC GGGGTTTCCA
CCGACGCGGC GGCGCAGAAC AACATGACGC GTGGTCGTCG CGGTCGCGGC GCGGGGGCGG GGCTCAGCGG CATTCCGTCG
AGCACGTGGC GCGCGCGCGC GAGTCGCGGT ACTTGTGGCC GTCCCCTCTC TCGCCGACGC GACGGCGCGC TGCCTCGCCG
AGAGAAGTAA GTTTTCTGCG TATCGCTGTG TGCTGACATG GTTGGTGGTG CCGTGCTGTG CTCTCCAGGC AATCGGGAAC
GCGCTCCACA TCCTCCCCAA CAAGAAGCAG CCGATGACCG TCCTCCATGA CGTCAGCGGG ATCATCAAGC CCCGGAGGTA
AAAACCCATA ACACAGCCAG CCATGCATCA TCTTCTTCTG CGTGTACCAG TGCATCATGA TTCATGGCGC TCGCGCTAAC
GCATCCATCC ATGGTGGTGC TCTCTGTGTA GGATGACCTT GCTGCTGGGA CCTCCTGGCT CGGGCAAGAC CACGTTGCTC
CTGGCGTTGG CAGGGAAGCT CGACAAGGAC CTCAAGGTCT CGGGGAAGGT GACCTACAAT GGACACGGGA TGCACGAGTT
CGTCCCGGAA AGGACCGCGG CGTACATCAG CCAGCATGAT CTCCACATCG GGGAGATGAC CGTGAGGGAG ACATTGGCCT
TCTCGGCGCG GTGCCAAGGC GTTGGCACTA GATATGGTAT GAACCTGAAT GCCAAGATTA CATGATACTC CTACCATCTA
ATGCTTATTG ACGCCTTTGA CATGAGTACT GAGGTTTGCT GTTTTTGCTT TGTTTAGAAA TGCTGACTGA GTTGGCAAGA
AGGGAAAAGG CAGCAAACAT CAAGCCAGAT CATGATATTG ATATCTACAT GAAGGTGATG ATGCTATCAC ATAAGAGTGT
TCTAGTTTTT TTTTCTCTCT CTTGGAATTG TATATGTAAC CAGGATTGCA TTGGCGAATC ATTTCAACAG GACATGTGAT
ATATACTATA CATGTCTACT AGCAATGTAA GTAACACCTT TTATATTTCA TACATGTAGG CCTCAGCTAT GGGAGGACAA
GAATCTAGTG TTGTTACGGA CTACATATTG AAGGTACAGT CTGCTAGCTG TGGATTAAAC CGTAGTACTA CAAATATGAT
TTCTTGTGGC ATTTGTGTAT GGATAATATC TCATTCCTGC TTCTCTGCTA CATAAATGCA GATATTAGGA TTGGATATTT
GTGCTGATAC GGTAGTAGGA AATGAGATGT TAAGGGGTAT ATCTGGTGGA CAACGGAAGC GTGTCACAAC AGGTATGACT
AACAGTCTTT AGCAAGATGG GGGTTGTTCT TTAAAGAAAA ACTCTAACTG TCCTATATGT TCACAGGTGA AATGCTTGTT
GGTCCAGCAA GAGCTTTGTT CATGGATGAG ATATCCACTG GACTGGACAG CTCAACCACG TACCAGATCG TGAATTCCCT
TAGGCAGACT ATCCACATCC TTGGCGGAAC TGCTGTCATC TCATTGCTCC AGCCAGCACC TGAAACATAC AACTTGTTTG
ATGACATTAT ACTCCTCTCT GACGGGCAGG TTGTGTACCA GGGTCCCCGT GAACATGTGC TTGAGTTCTT TGAGTTCATG
GGCTTCAGAT GCCCTGCCAG AAAGGGTGTT GCTGATTTCT TGCAGGAGGT ATGTGCTGTT TATCATCTGT AAAAATTCAT
GCCATTTACT GCACAAGGTT TTCAAAATAG ACAGTACTGA TATCTCTGAA TTTGTTGAAA AAGGTGACAT CAAGGAAAGA
TCAGGGGCAG TACTGGTGTA GGCGTGACAG ACCATACCGT TTTGTGCCAG TGAAGCAATT CGCAGATGCG TTCCGTTCCT
TCCATGTGGG CCGATCCATA CAGAATGAGC TTTCTGAGCC ATTTGATAGG ACCAGGAGCC ACCCTGCTGC TCTGGCTACT
TCAAAGTATG GTGTCAGCAG GAAGGAGTTG CTCAAAGCCA CTATCGATAG AGAGCTTCTT CTCATGAAGA GGAATGCATT
TATGTACATT TTTAAAGCTG TTAATGTAAG TTCATATCTC TGGTGCACTA ATTTTGATTC AAGATATCGA TCGATCGATC
TGATCATCTG AAACTTTCTT TCATTGCAGC TAACTCTAAT GGCATTGATC GTGATGACCA CATTTTTCCG TACCAGCATG
CGACATGATA GAGATTATGG AATGATCTAT CTGGGGGCAT TGTACTTTGC TCTTGACACA GTCATGTTTA ATGGTTTCGC
AGAGCTTGCC ATGACTGTCA TGAAACTACC TGTTTTCTTC AAGCAAAGGG ATCTTCTCTT CTTTCCTGCA TGGGCCTACA
CCATACCATC ATGGATTCTT CAGATTCCTA TCACATTTCT CGAAGTTGGT GTTTATGTTT TCATAACATA CTATGTCATT
GGATTTGATC CCAGTGTAAG CAGGTAAGAT GCATTGATGC AGATATCTAC ATGCCTAAAA GAATCCAAGA AATAAGCTTA
TTTTGTATGC AGATATCTAT TATTTTGCAA GGTGTTGCCT AGTATATTGA TAGAAATGTT CCACAATAAA TGAGTCTATT
CTGTGAAGTC TGAAACTCTG AATAACTTTT TGTGCATAGG TTCTTCAAGC AGTATCTGCT GCTACTTGCA CTCAACCAGA
TGTCATCTGC ACTATTCCGC TTCATTGCTG GAATCGGAAG AGACATGGTT GTGTCTCACA CATTTGGACC CTTATCACTG
TTGGCTTTTG CAGCATTGGG TGGCTTTATC CTTGCAAGAC GTAAGTTACT GGATTCCCTT TCAATAATTG CATGTTCTTA
TATGTACTTG AAATTGATGG TTTTAAATGC TAATTGTTCC TGACATGTTT CTCTTTTATA GCTGACGTGA AGAAATGGTG
GATTTGGGGT TACTGGATAT CCCCGCTATC GTATGCACAA AATGCTATTT CGACAAATGA ATTTTTGGGT CACAGTTGGA
GCCAAGTTAG TGCCACATTT CTTCACCAGC AATTGAACTT GCAATGTTAT AAACTGTAAA ACTGAACATG TATTTTGCAT
GTCACAGATA CTTCCTGGAG AAAATGTGAC CTTGGGAGTT AGTGTACTAA AATCTCGTGG TATCTTTACT GAAGCTAAGT
GGTACTGGAT TGGACTTGGT GCTTTGCTTG GATACACTCT CCTCTTTAAC CTGCTCTACA CTGTAGCTCT TTCAGTTTTG
AGTCGTAAGT ATATTTGAAA GACATTTTTT AGAACTCCAA AATATCTAAT CAACATTTGC GAGCTAAAAG ATAATAACTG
TGGCTACTTG AATTTTTTTC GCAGCATTCA CTGACTCTCA TGCATCAATG TCTGAGGACG CATTGAAAGA GAAGCATGCC
AACTTAACCG GTGAAGTTGT AGAGGGACAG AAGGACACTA AATCTAGGAA GCAGGAATTG GAATTGTCCC ATATTGCTGA
CCAAAACTCT GGAATTAACA GCGCTGATTC TAGCGCAAGC AGGAAGGGAA TGGTGCTCCC ATTTGCACCA CTATCTATTA
GTTTTAACGA CGTAAGATAC TCAGTGGACA TGCCAGAGGT AATTTTGCTC AGAACGACTA CAAGTGCGTA AAAATCATTA
TGTTAACACA GGTTTTTAAC CCAATTATGT TGTTTTATAT TAACAGGCAA TGAAAGCACA AGGCATAACA GAAGACCGTT
TGTTGCTTCT AAAGGGTGTT AGTGGTTCTT TCAGGCCAGG TGTACTTACT GCATTGATGG GTGTAAGTGG TGCCGGGAAG
ACAACACTGA TGGATGTTTT AGCAGGGAGA AAAACTGGAG GATACATAGA GGGAGATATT AGAATATCTG GCTATCCAAA
GAAGCAAGAG ACCTTTGCAC GTATATCAGG ATATTGTGAG CAAAATGACA TCCATTCTCC CCATGTGACA GTATATGAAT
CACTTGTGTT CTCTGCATGG CTGCGGCTAC CCTCGGAGGT TGATTCAGAA GCAAGAAAGG TTAGTTAGCT AGATTATGGG
CTAACATTTG TTTCTTGTGT ATGTTTTTCG GTTGTTAACT GACTGTACAT CTTACGCGCT GAACCATGAT TACAGATGTT
TATTGAGGAG GTCATGGATC TTGTAGAGCT CACATCTCTG AGGGGAGCAC TTGTTGGGCT TCCTGGAGTG AGCGGCCTGT
CAACTGAGCA ACGCAAGAGA CTTACTATTG CTGTGGAGCT TGTTGCAAAC CCTTCAATTA TTTTTATGGA TGAGCCAACA
TCTGGTCTTG ATGCTCGGGC AGCTGCGATT GTGATGAGGA CCGTAAGGAA CACCGTTAAC ACTGGCAGGA CTGTTGTTTG
TACCATTCAC CAGCCAAGTA TTGACATCTT TGAAGCATTT GATGAGGTGA CTAGTTGTTT CTTTGGGAAG TTATCCTTTG
ATTCATTAGA TGAACTCTGT ATATTAACTA CGTTGCTGTT CACCTTATCT ACAGCTTTTC CTAATGAAGA GAGGAGGTGA
AGAGATATAT GTTGGTCCAG TGGGCCAGAA TTCCTCAAAA CTGATTGAGT ACTTTGAGGT AAGAACGGAA AATCAACATA
AATAACAATC ATCTCTTCAT GCTTCAGCAC GTAGGCTGAC TAAGTCACAT CAAACGGAAA TTCCGTTGTT CATTTGTTCA
GGGAATTGAT GGCGTTAGTA GGATAAAAGA TGGATATAAT CCAGCAACAT GGATGTTGGA AGTGACCTCT TCAGCCCAGG
AGGAGATGCT CGGTGTTGAT TTTAGTGAAA TCTACAGGCA GTCAGAGCTA TATCAGTAAG CTTCGGCACA TGCCATTCTG
ATTAATAGAA TGAATAGTGT ATTTGAACTG CAATTCTAAT TATTATTATT ATTATTTTGC ATATTTGCAA TTTCAGAAGG
AACAAGGAAC TTATTGAGGA GCTAAGCACA CCACCTCCTG GCTCTACTGA TCTCAACTTC CCTACGCAGT ACTCTAGATC
GTTCATTACA CAGTGCCTAG CTTGCTTGTG GAAGCAGAAT TGGTCATATT GGAGGAATCC ATCCTACACT GCAGTGAGAT
TACTCTTCAC TATCGTCATT GCCCTAATGT TTGGAACAAT GTTCTGGAAC CTTGGAACGA GAACGTACGT CTCTAACATA
TGTTCTTATT ATTTTAATCT GTTTGACAAA TAACTTCTAA ACCTTTACTC ATCATATCTT GTTGCAGTAA AAAACAACAG
GATCTATTCA ATGCCATGGG ATCAATGTAT GCTGCAGTTC TCTACATTGG AGTGCAAAAC TCTGGTTCTG TTCAACCAGT
GGTGGTGGTG GAGCGAACAG TCTTTTACCG AGAAAGAGCA GCTGGCATGT ATTCAGCTTT CCCGTATGCA TTTGGACAGG
TAATTTGTCT TTTAGACTCT CGGTTGGCCT AGTTCTAATC TCATGTATAT AATGTATGAC TTCAAAGACT CTGATGCCTG
AATTCTGACT TGCATTTGGG ATTGAACTGA AATGGCTGTG CAATAAGCTA TTCGTTAGCA CTGTCAAGCT CTTTTGGTCC
CATAACCTAA CAATGCCACT TTTCCCTTTT TAGGTTGCAA TTGAGTTACC ATACATCATG GTTCAGACTC TGATATATGG
CGTGCTGGTA TACTCAATGA TTGGATTTGA GTGGACTGTT GCCAAGTTCT TGTGGTACTT GTTCTTCATG TACTTCACAC
TGCTATATTT CACATTTTAC GGAATGATGG CGGTAGGGTT GACACCAAAT GAGAGCATAG CAGCAATCAT CTCGTCCGCT
TTCTACAATG TGTGGAACCT CTTCTCAGGA TATCTGATCC CTCGACCGGT AGGTTATTCT CCCATCTCAA TTTCGCCCCC
TTTCTTTTCT CATGAAATGT CGCTTTTATT AGTCCTTTAG AACCGTTTTA AATTTCTCTA CAGAAAATCC CTGTTTGGTG
GAGGTGGTAC TGTTGGATTT GCCCGGTTGC ATGGACTTTG TATGGATTAG TTGCTTCCCA GTTTGGTGAT ATCCAACATG
TGCTCGAAGG CGACACCAGA ACTGTTGCAC AGTTTGTCAC TGATTACTTT GGCTTCCATC ATAACTTCCT GTGGGTGGTG
GCCGTGGTGC ACGTCGTCTT CGCCGTGACC TTCGCCTTCC TCTTCAGTTT TGCGATCATG AAGTTCAACT TCCAGAGGAG
ATGAGAAAGT GATCATTCTT TTTTGCATTC GTTCTATTGT ACTACTGAAT AGCTATTAGC TATCCTGTAA ATGGTATAGA
GATCATCTTC TAGTATTTCA TTATTTCAAG CATGTAAAAA TTCGGACATC TAGTAGGATT CTCTAGGAAA AAGAACCCTT
GTTGAGCTTC CTGCCTCTTG ACCAGCTCTA GCTGATAAAT GTCGGATGCA GATGAATGTA AAGTATGGCC TTCAATGTTT
TCATTTTTGT CGAATTAATG AAAGCAGAAA ATTTGTTGAT 

Locus: Os01g0609900

Loading...

Locus: Os01g0609900

Loading...