Os01t0609900-02

Locus

Os01g0609900

Description

Similar to PDR-like ABC transporter (PDR4 ABC transporter).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PDR8

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 8

Oryzabase Gene Symbol Synonym(s)

OsPDR8, PDR4, P0410E03.16, OsABCG37, OsPDR4

Oryzabase Gene Name Synonym(s)

sativa pleiotropic drug resistance 8, Pleiotropic drug resistance protein 4, ABC transporter superfamily ABCG subgroup member 37, pleiotropic drug resistance 4

Transcript Evidence

AK065988 (DDBJ, Best hit)

Protein Evidence

Q8GU89 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Functional domain (InterPro)

ABC transporter-like (IPR003439)

ATPase, AAA+ type, core (IPR003593)

ABC-2 type transporter (IPR013525)

Plant PDR ABC transporter associated (IPR013581)

Full-length cDNA

J013043D14 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0609900-02)

RiceXPro (AK065988)

Others

Oryzabase (8340)

KEGG (Os01t0609900-02)

Transcript

4445 bp

>Os01t0609900-02 Similar to PDR-like ABC transporter (PDR4 ABC transporter).
gtgtcgtcggaggacggcggcgccggcggggagaaggtggaggtggacgtggggaggctg
ggggcgagggagagcagggcgctgatcgagcggctggtccgcgccgccgacgaCGACCAC
GAGCGGTTCCTCCTCAAGCTCCGGGAGCGGATGGACCGCGTGGGGATCGACTACCCCACC
ATCGAGGTGCGGTTCGAGAACCTCGAGGTGGAGGCCGACGTCCACGTCGGCAACCGCGGC
CTCCCCACCCTCCTCAACTCCGTCACCAACACCGTCGAGGCAATCGGGAACGCGCTCCAC
ATCCTCCCCAACAAGAAGCAGCCGATGACCGTCCTCCATGACGTCAGCGGGATCATCAAG
CCCCGGAGGATGACCTTGCTGCTGGGACCTCCTGGCTCGGGCAAGACCACGTTGCTCCTG
GCGTTGGCAGGGAAGCTCGACAAGGACCTCAAGGTCTCGGGGAAGGTGACCTACAATGGA
CACGGGATGCACGAGTTCGTCCCGGAAAGGACCGCGGCGTACATCAGCCAGCATGATCTC
CACATCGGGGAGATGACCGTGAGGGAGACATTGGCCTTCTCGGCGCGGTGCCAAGGCGTT
GGCACTAGATATGAAATGCTGACTGAGTTGGCAAGAAGGGAAAAGGCAGCAAACATCAAG
CCAGATCATGATATTGATATCTACATGAAGGCCTCAGCTATGGGAGGACAAGAATCTAGT
GTTGTTACGGACTACATATTGAAGATATTAGGATTGGATATTTGTGCTGATACGGTAGTA
GGAAATGAGATGTTAAGGGGTATATCTGGTGGACAACGGAAGCGTGTCACAACAGGTGAA
ATGCTTGTTGGTCCAGCAAGAGCTTTGTTCATGGATGAGATATCCACTGGACTGGACAGC
TCAACCACGTACCAGATCGTGAATTCCCTTAGGCAGACTATCCACATCCTTGGCGGAACT
GCTGTCATCTCATTGCTCCAGCCAGCACCTGAAACATACAACTTGTTTGATGACATTATA
CTCCTCTCTGACGGGCAGGTTGTGTACCAGGGTCCCCGTGAACATGTGCTTGAGTTCTTT
GAGTTCATGGGCTTCAGATGCCCTGCCAGAAAGGGTGTTGCTGATTTCTTGCAGGAGGTG
ACATCAAGGAAAGATCAGGGGCAGTACTGGTGTAGGCGTGACAGACCATACCGTTTTGTG
CCAGTGAAGCAATTCGCAGATGCGTTCCGTTCCTTCCATGTGGGCCGATCCATACAGAAT
GAGCTTTCTGAGCCATTTGATAGGACCAGGAGCCACCCTGCTGCTCTGGCTACTTCAAAG
TATGGTGTCAGCAGGAAGGAGTTGCTCAAAGCCACTATCGATAGAGAGCTTCTTCTCATG
AAGAGGAATGCATTTATGTACATTTTTAAAGCTGTTAATCTAACTCTAATGGCATTGATC
GTGATGACCACATTTTTCCGTACCAGCATGCGACATGATAGAGATTATGGAATGATCTAT
CTGGGGGCATTGTACTTTGCTCTTGACACAGTCATGTTTAATGGTTTCGCAGAGCTTGCC
ATGACTGTCATGAAACTACCTGTTTTCTTCAAGCAAAGGGATCTTCTCTTCTTTCCTGCA
TGGGCCTACACCATACCATCATGGATTCTTCAGATTCCTATCACATTTCTCGAAGTTGGT
GTTTATGTTTTCATAACATACTATGTCATTGGATTTGATCCCAGTGTAAGCAGGTTCTTC
AAGCAGTATCTGCTGCTACTTGCACTCAACCAGATGTCATCTGCACTATTCCGCTTCATT
GCTGGAATCGGAAGAGACATGGTTGTGTCTCACACATTTGGACCCTTATCACTGTTGGCT
TTTGCAGCATTGGGTGGCTTTATCCTTGCAAGACCTGACGTGAAGAAATGGTGGATTTGG
GGTTACTGGATATCCCCGCTATCGTATGCACAAAATGCTATTTCGACAAATGAATTTTTG
GGTCACAGTTGGAGCCAAATACTTCCTGGAGAAAATGTGACCTTGGGAGTTAGTGTACTA
AAATCTCGTGGTATCTTTACTGAAGCTAAGTGGTACTGGATTGGACTTGGTGCTTTGCTT
GGATACACTCTCCTCTTTAACCTGCTCTACACTGTAGCTCTTTCAGTTTTGAGTCCATTC
ACTGACTCTCATGCATCAATGTCTGAGGACGCATTGAAAGAGAAGCATGCCAACTTAACC
GGTGAAGTTGTAGAGGGACAGAAGGACACTAAATCTAGGAAGCAGGAATTGGAATTGTCC
CATATTGCTGACCAAAACTCTGGAATTAACAGCGCTGATTCTAGCGCAAGCAGGAAGGGA
ATGGTGCTCCCATTTGCACCACTATCTATTAGTTTTAACGACGTAAGATACTCAGTGGAC
ATGCCAGAGGCAATGAAAGCACAAGGCATAACAGAAGACCGTTTGTTGCTTCTAAAGGGT
GTTAGTGGTTCTTTCAGGCCAGGTGTACTTACTGCATTGATGGGTGTAAGTGGTGCCGGG
AAGACAACACTGATGGATGTTTTAGCAGGGAGAAAAACTGGAGGATACATAGAGGGAGAT
ATTAGAATATCTGGCTATCCAAAGAAGCAAGAGACCTTTGCACGTATATCAGGATATTGT
GAGCAAAATGACATCCATTCTCCCCATGTGACAGTATATGAATCACTTGTGTTCTCTGCA
TGGCTGCGGCTACCCTCGGAGGTTGATTCAGAAGCAAGAAAGATGTTTATTGAGGAGGTC
ATGGATCTTGTAGAGCTCACATCTCTGAGGGGAGCACTTGTTGGGCTTCCTGGAGTGAGC
GGCCTGTCAACTGAGCAACGCAAGAGACTTACTATTGCTGTGGAGCTTGTTGCAAACCCT
TCAATTATTTTTATGGATGAGCCAACATCTGGTCTTGATGCTCGGGCAGCTGCGATTGTG
ATGAGGACCGTAAGGAACACCGTTAACACTGGCAGGACTGTTGTTTGTACCATTCACCAG
CCAAGTATTGACATCTTTGAAGCATTTGATGAGCTTTTCCTAATGAAGAGAGGAGGTGAA
GAGATATATGTTGGTCCAGTGGGCCAGAATTCCTCAAAACTGATTGAGTACTTTGAGGGA
ATTGATGGCGTTAGTAGGATAAAAGATGGATATAATCCAGCAACATGGATGTTGGAAGTG
ACCTCTTCAGCCCAGGAGGAGATGCTCGGTGTTGATTTTAGTGAAATCTACAGGCAGTCA
GAGCTATATCAAAGGAACAAGGAACTTATTGAGGAGCTAAGCACACCACCTCCTGGCTCT
ACTGATCTCAACTTCCCTACGCAGTACTCTAGATCGTTCATTACACAGTGCCTAGCTTGC
TTGTGGAAGCAGAATTGGTCATATTGGAGGAATCCATCCTACACTGCAGTGAGATTACTC
TTCACTATCGTCATTGCCCTAATGTTTGGAACAATGTTCTGGAACCTTGGAACGAGAACT
AAAAAACAACAGGATCTATTCAATGCCATGGGATCAATGTATGCTGCAGTTCTCTACATT
GGAGTGCAAAACTCTGGTTCTGTTCAACCAGTGGTGGTGGTGGAGCGAACAGTCTTTTAC
CGAGAAAGAGCAGCTGGCATGTATTCAGCTTTCCCGTATGCATTTGGACAGGTTGCAATT
GAGTTACCATACATCATGGTTCAGACTCTGATATATGGCGTGCTGGTATACTCAATGATT
GGATTTGAGTGGACTGTTGCCAAGTTCTTGTGGTACTTGTTCTTCATGTACTTCACACTG
CTATATTTCACATTTTACGGAATGATGGCGGTAGGGTTGACACCAAATGAGAGCATAGCA
GCAATCATCTCGTCCGCTTTCTACAATGTGTGGAACCTCTTCTCAGGATATCTGATCCCT
CGACCGAAAATCCCTGTTTGGTGGAGGTGGTACTGTTGGATTTGCCCGGTTGCATGGACT
TTGTATGGATTAGTTGCTTCCCAGTTTGGTGATATCCAACATGTGCTCGAAGGCGACACC
AGAACTGTTGCACAGTTTGTCACTGATTACTTTGGCTTCCATCATAACTTCCTGTGGGTG
GTGGCCGTGGTGCACGTCGTCTTCGCCGTGACCTTCGCCTTCCTCTTCAGTTTTGCGATC
ATGAAGTTCAACTTCCAGAGGAGATGAGAAAGTGATCATTCTTTTTTGCATTCGTTCTAT
TGTACTACTGAATAGCTATTAGCTATCCTGTAAATGGTATAGAGATCATCTTCTAGTATT
TCATTATTTCAAGCATGTAAAAATTCGGACATCTAGTAGGATTCTCTAGGAAAAAGAACC
CTTGTTGAGCTTCCTGCCTCTTGACCAGCTCTAGCTGATAAATGTCGGATGCAGATGAAT
GTAAAGTATGGCCTTCAATGTTTTCATTTTTGTCGAATTAATGAAAGCAGAAAATTTGTT
GATTC

CDS

4167 bp

>Os01t0609900-02 Similar to PDR-like ABC transporter (PDR4 ABC transporter).
gtgtcgtcggaggacggcggcgccggcggggagaaggtggaggtggacgtggggaggctg
ggggcgagggagagcagggcgctgatcgagcggctggtccgcgccgccgacgaCGACCAC
GAGCGGTTCCTCCTCAAGCTCCGGGAGCGGATGGACCGCGTGGGGATCGACTACCCCACC
ATCGAGGTGCGGTTCGAGAACCTCGAGGTGGAGGCCGACGTCCACGTCGGCAACCGCGGC
CTCCCCACCCTCCTCAACTCCGTCACCAACACCGTCGAGGCAATCGGGAACGCGCTCCAC
ATCCTCCCCAACAAGAAGCAGCCGATGACCGTCCTCCATGACGTCAGCGGGATCATCAAG
CCCCGGAGGATGACCTTGCTGCTGGGACCTCCTGGCTCGGGCAAGACCACGTTGCTCCTG
GCGTTGGCAGGGAAGCTCGACAAGGACCTCAAGGTCTCGGGGAAGGTGACCTACAATGGA
CACGGGATGCACGAGTTCGTCCCGGAAAGGACCGCGGCGTACATCAGCCAGCATGATCTC
CACATCGGGGAGATGACCGTGAGGGAGACATTGGCCTTCTCGGCGCGGTGCCAAGGCGTT
GGCACTAGATATGAAATGCTGACTGAGTTGGCAAGAAGGGAAAAGGCAGCAAACATCAAG
CCAGATCATGATATTGATATCTACATGAAGGCCTCAGCTATGGGAGGACAAGAATCTAGT
GTTGTTACGGACTACATATTGAAGATATTAGGATTGGATATTTGTGCTGATACGGTAGTA
GGAAATGAGATGTTAAGGGGTATATCTGGTGGACAACGGAAGCGTGTCACAACAGGTGAA
ATGCTTGTTGGTCCAGCAAGAGCTTTGTTCATGGATGAGATATCCACTGGACTGGACAGC
TCAACCACGTACCAGATCGTGAATTCCCTTAGGCAGACTATCCACATCCTTGGCGGAACT
GCTGTCATCTCATTGCTCCAGCCAGCACCTGAAACATACAACTTGTTTGATGACATTATA
CTCCTCTCTGACGGGCAGGTTGTGTACCAGGGTCCCCGTGAACATGTGCTTGAGTTCTTT
GAGTTCATGGGCTTCAGATGCCCTGCCAGAAAGGGTGTTGCTGATTTCTTGCAGGAGGTG
ACATCAAGGAAAGATCAGGGGCAGTACTGGTGTAGGCGTGACAGACCATACCGTTTTGTG
CCAGTGAAGCAATTCGCAGATGCGTTCCGTTCCTTCCATGTGGGCCGATCCATACAGAAT
GAGCTTTCTGAGCCATTTGATAGGACCAGGAGCCACCCTGCTGCTCTGGCTACTTCAAAG
TATGGTGTCAGCAGGAAGGAGTTGCTCAAAGCCACTATCGATAGAGAGCTTCTTCTCATG
AAGAGGAATGCATTTATGTACATTTTTAAAGCTGTTAATCTAACTCTAATGGCATTGATC
GTGATGACCACATTTTTCCGTACCAGCATGCGACATGATAGAGATTATGGAATGATCTAT
CTGGGGGCATTGTACTTTGCTCTTGACACAGTCATGTTTAATGGTTTCGCAGAGCTTGCC
ATGACTGTCATGAAACTACCTGTTTTCTTCAAGCAAAGGGATCTTCTCTTCTTTCCTGCA
TGGGCCTACACCATACCATCATGGATTCTTCAGATTCCTATCACATTTCTCGAAGTTGGT
GTTTATGTTTTCATAACATACTATGTCATTGGATTTGATCCCAGTGTAAGCAGGTTCTTC
AAGCAGTATCTGCTGCTACTTGCACTCAACCAGATGTCATCTGCACTATTCCGCTTCATT
GCTGGAATCGGAAGAGACATGGTTGTGTCTCACACATTTGGACCCTTATCACTGTTGGCT
TTTGCAGCATTGGGTGGCTTTATCCTTGCAAGACCTGACGTGAAGAAATGGTGGATTTGG
GGTTACTGGATATCCCCGCTATCGTATGCACAAAATGCTATTTCGACAAATGAATTTTTG
GGTCACAGTTGGAGCCAAATACTTCCTGGAGAAAATGTGACCTTGGGAGTTAGTGTACTA
AAATCTCGTGGTATCTTTACTGAAGCTAAGTGGTACTGGATTGGACTTGGTGCTTTGCTT
GGATACACTCTCCTCTTTAACCTGCTCTACACTGTAGCTCTTTCAGTTTTGAGTCCATTC
ACTGACTCTCATGCATCAATGTCTGAGGACGCATTGAAAGAGAAGCATGCCAACTTAACC
GGTGAAGTTGTAGAGGGACAGAAGGACACTAAATCTAGGAAGCAGGAATTGGAATTGTCC
CATATTGCTGACCAAAACTCTGGAATTAACAGCGCTGATTCTAGCGCAAGCAGGAAGGGA
ATGGTGCTCCCATTTGCACCACTATCTATTAGTTTTAACGACGTAAGATACTCAGTGGAC
ATGCCAGAGGCAATGAAAGCACAAGGCATAACAGAAGACCGTTTGTTGCTTCTAAAGGGT
GTTAGTGGTTCTTTCAGGCCAGGTGTACTTACTGCATTGATGGGTGTAAGTGGTGCCGGG
AAGACAACACTGATGGATGTTTTAGCAGGGAGAAAAACTGGAGGATACATAGAGGGAGAT
ATTAGAATATCTGGCTATCCAAAGAAGCAAGAGACCTTTGCACGTATATCAGGATATTGT
GAGCAAAATGACATCCATTCTCCCCATGTGACAGTATATGAATCACTTGTGTTCTCTGCA
TGGCTGCGGCTACCCTCGGAGGTTGATTCAGAAGCAAGAAAGATGTTTATTGAGGAGGTC
ATGGATCTTGTAGAGCTCACATCTCTGAGGGGAGCACTTGTTGGGCTTCCTGGAGTGAGC
GGCCTGTCAACTGAGCAACGCAAGAGACTTACTATTGCTGTGGAGCTTGTTGCAAACCCT
TCAATTATTTTTATGGATGAGCCAACATCTGGTCTTGATGCTCGGGCAGCTGCGATTGTG
ATGAGGACCGTAAGGAACACCGTTAACACTGGCAGGACTGTTGTTTGTACCATTCACCAG
CCAAGTATTGACATCTTTGAAGCATTTGATGAGCTTTTCCTAATGAAGAGAGGAGGTGAA
GAGATATATGTTGGTCCAGTGGGCCAGAATTCCTCAAAACTGATTGAGTACTTTGAGGGA
ATTGATGGCGTTAGTAGGATAAAAGATGGATATAATCCAGCAACATGGATGTTGGAAGTG
ACCTCTTCAGCCCAGGAGGAGATGCTCGGTGTTGATTTTAGTGAAATCTACAGGCAGTCA
GAGCTATATCAAAGGAACAAGGAACTTATTGAGGAGCTAAGCACACCACCTCCTGGCTCT
ACTGATCTCAACTTCCCTACGCAGTACTCTAGATCGTTCATTACACAGTGCCTAGCTTGC
TTGTGGAAGCAGAATTGGTCATATTGGAGGAATCCATCCTACACTGCAGTGAGATTACTC
TTCACTATCGTCATTGCCCTAATGTTTGGAACAATGTTCTGGAACCTTGGAACGAGAACT
AAAAAACAACAGGATCTATTCAATGCCATGGGATCAATGTATGCTGCAGTTCTCTACATT
GGAGTGCAAAACTCTGGTTCTGTTCAACCAGTGGTGGTGGTGGAGCGAACAGTCTTTTAC
CGAGAAAGAGCAGCTGGCATGTATTCAGCTTTCCCGTATGCATTTGGACAGGTTGCAATT
GAGTTACCATACATCATGGTTCAGACTCTGATATATGGCGTGCTGGTATACTCAATGATT
GGATTTGAGTGGACTGTTGCCAAGTTCTTGTGGTACTTGTTCTTCATGTACTTCACACTG
CTATATTTCACATTTTACGGAATGATGGCGGTAGGGTTGACACCAAATGAGAGCATAGCA
GCAATCATCTCGTCCGCTTTCTACAATGTGTGGAACCTCTTCTCAGGATATCTGATCCCT
CGACCGAAAATCCCTGTTTGGTGGAGGTGGTACTGTTGGATTTGCCCGGTTGCATGGACT
TTGTATGGATTAGTTGCTTCCCAGTTTGGTGATATCCAACATGTGCTCGAAGGCGACACC
AGAACTGTTGCACAGTTTGTCACTGATTACTTTGGCTTCCATCATAACTTCCTGTGGGTG
GTGGCCGTGGTGCACGTCGTCTTCGCCGTGACCTTCGCCTTCCTCTTCAGTTTTGCGATC
ATGAAGTTCAACTTCCAGAGGAGATGA

Protein

1388 aa

>Os01t0609900-02 Similar to PDR-like ABC transporter (PDR4 ABC transporter).
VSSEDGGAGGEKVEVDVGRLGARESRALIERLVRAADDDHERFLLKLRERMDRVGIDYPT
IEVRFENLEVEADVHVGNRGLPTLLNSVTNTVEAIGNALHILPNKKQPMTVLHDVSGIIK
PRRMTLLLGPPGSGKTTLLLALAGKLDKDLKVSGKVTYNGHGMHEFVPERTAAYISQHDL
HIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAANIKPDHDIDIYMKASAMGGQESS
VVTDYILKILGLDICADTVVGNEMLRGISGGQRKRVTTGEMLVGPARALFMDEISTGLDS
STTYQIVNSLRQTIHILGGTAVISLLQPAPETYNLFDDIILLSDGQVVYQGPREHVLEFF
EFMGFRCPARKGVADFLQEVTSRKDQGQYWCRRDRPYRFVPVKQFADAFRSFHVGRSIQN
ELSEPFDRTRSHPAALATSKYGVSRKELLKATIDRELLLMKRNAFMYIFKAVNLTLMALI
VMTTFFRTSMRHDRDYGMIYLGALYFALDTVMFNGFAELAMTVMKLPVFFKQRDLLFFPA
WAYTIPSWILQIPITFLEVGVYVFITYYVIGFDPSVSRFFKQYLLLLALNQMSSALFRFI
AGIGRDMVVSHTFGPLSLLAFAALGGFILARPDVKKWWIWGYWISPLSYAQNAISTNEFL
GHSWSQILPGENVTLGVSVLKSRGIFTEAKWYWIGLGALLGYTLLFNLLYTVALSVLSPF
TDSHASMSEDALKEKHANLTGEVVEGQKDTKSRKQELELSHIADQNSGINSADSSASRKG
MVLPFAPLSISFNDVRYSVDMPEAMKAQGITEDRLLLLKGVSGSFRPGVLTALMGVSGAG
KTTLMDVLAGRKTGGYIEGDIRISGYPKKQETFARISGYCEQNDIHSPHVTVYESLVFSA
WLRLPSEVDSEARKMFIEEVMDLVELTSLRGALVGLPGVSGLSTEQRKRLTIAVELVANP
SIIFMDEPTSGLDARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIFEAFDELFLMKRGGE
EIYVGPVGQNSSKLIEYFEGIDGVSRIKDGYNPATWMLEVTSSAQEEMLGVDFSEIYRQS
ELYQRNKELIEELSTPPPGSTDLNFPTQYSRSFITQCLACLWKQNWSYWRNPSYTAVRLL
FTIVIALMFGTMFWNLGTRTKKQQDLFNAMGSMYAAVLYIGVQNSGSVQPVVVVERTVFY
RERAAGMYSAFPYAFGQVAIELPYIMVQTLIYGVLVYSMIGFEWTVAKFLWYLFFMYFTL
LYFTFYGMMAVGLTPNESIAAIISSAFYNVWNLFSGYLIPRPKIPVWWRWYCWICPVAWT
LYGLVASQFGDIQHVLEGDTRTVAQFVTDYFGFHHNFLWVVAVVHVVFAVTFAFLFSFAI
MKFNFQRR*

CDS

chr01:24114700..24114978 (- strand) : 279 bp

chr01:24113211..24113299 (- strand) : 89 bp

chr01:24112852..24113096 (- strand) : 245 bp

chr01:24112674..24112750 (- strand) : 77 bp

chr01:24112455..24112508 (- strand) : 54 bp

chr01:24112256..24112346 (- strand) : 91 bp

chr01:24111880..24112181 (- strand) : 302 bp

chr01:24111503..24111784 (- strand) : 282 bp

chr01:24111105..24111418 (- strand) : 314 bp

chr01:24110768..24110928 (- strand) : 161 bp

chr01:24110563..24110666 (- strand) : 104 bp

chr01:24110324..24110480 (- strand) : 157 bp

chr01:24109970..24110223 (- strand) : 254 bp

chr01:24109549..24109881 (- strand) : 333 bp

chr01:24109162..24109452 (- strand) : 291 bp

chr01:24108990..24109073 (- strand) : 84 bp

chr01:24108753..24108886 (- strand) : 134 bp

chr01:24108424..24108651 (- strand) : 228 bp

chr01:24108169..24108340 (- strand) : 172 bp

chr01:24107720..24107974 (- strand) : 255 bp

chr01:24107364..24107624 (- strand) : 261 bp

3'UTR

chr01:24107086..24107363 (- strand) : 278 bp

FASTA

>Os01t0609900-02 class=Sequence position=chr01:24107086..24114978 (- strand)
gtgtcgtcgg aggacggcgg cgccggcggg gagaaggtgg aggtggacgt ggggaggctg ggggcgaggg agagcagggc
gctgatcgag cggctggtcc gcgccgccga cgaCGACCAC GAGCGGTTCC TCCTCAAGCT CCGGGAGCGG ATGGACCGCG
TGGGGATCGA CTACCCCACC ATCGAGGTGC GGTTCGAGAA CCTCGAGGTG GAGGCCGACG TCCACGTCGG CAACCGCGGC
CTCCCCACCC TCCTCAACTC CGTCACCAAC ACCGTCGAGG TACGTGCGTA CGTAACTACT ACCGCGTGAA TTTTCCTCGT
GGTGGTTTGA TGGCGCGGCG CGATGCCGCG ATGTAACGTG AGGAGAAGGC AAACGCTTTT TGTTTTTGAG ATGATGAAAC
GATTCGAGAG Agaggccgag tttagtttca aattttttct tcaaattttt aatttttttc attatattaa aattttctta
catacaaact tttaactttt tcgttatatc attccaattt taatcaaatt ttcaatttta gcgtgggcta aacacaccAG
AGGTAGGTGA GCGTGGCCAC GGTCTCCGCG GCGTCGCGCG CGGACGCCGC TAGCTTTGGC TACATCCGGT CAAACGGTGG
GACGGACAGA GCGTGCACTC GGTGGCGCCG GCGCCGGCGC CACGGCGCCA CCGAACGCAG CACGCACGTG TTGGGTTGGG
TTACTGTTGC TACGCTCAGC TTTAGTTTTG TGCCCTGGGC TACCCGACGA GTTGGCCCAA TTGCCGGGGA GACTTGGCAC
TTGTGCAAGT GCAGGTTAAT TACAAGCAAG CAACGTGTAC TCTTGTCGTG TGAGGTGTGT TTGCGTACGG CACCGTTCGA
TTCTGGGTGA TGAAGATTAA CTAGAGGCAC ATAAAATAAG AAAATTATTA ACATATGATC AACTAAGTTT TAATTATTTT
AAACCGATAA AATAGATTTA TTTGTTATTT TAAAATATTT TTTATATAAA ATGTTTTTAT ACGAGACGTA CCCGTTTTGA
AAATCTATAT CTTAAATTAA TAAAAAAACC ATTATTGATT ATTTTTAAAG GAATAGTTAA ATCCTGAAAA AAAAGTTGTG
GATGAACAGA TCAAATAGTA AAATTAAGAT TTTTTTTGGG ATAGGAAAAG GTGAAGGAAA AAAAAAACGT TTTCTTGAAA
AGAAGGGAAA CAAGGAGCAG ATATAGTGGA GCCCACTAAG CTAAAAGCCC CCATGGCGGG CCCGGCCTGC AGGGAGACTC
TTTCTGGTTC GGGTTCAACC AAACTAGTTG ACCGTTTCCA CTATCCACCA ACCTCCCACC CTCTCCCCGC CACCTCCCAC
CTTACCGCCG CCGCCGCCGT CGCTGGCGGC GCCGCGGCGG CGAGACGGCG ACCGCTTTTC CTACCTCGAA TGAGTTCTCA
CGGGGTTTCC ACCGACGCGG CGGCGCAGAA CAACATGACG CGTGGTCGTC GCGGTCGCGG CGCGGGGGCG GGGCTCAGCG
GCATTCCGTC GAGCACGTGG CGCGCGCGCG CGAGTCGCGG TACTTGTGGC CGTCCCCTCT CTCGCCGACG CGACGGCGCG
CTGCCTCGCC GAGAGAAGTA AGTTTTCTGC GTATCGCTGT GTGCTGACAT GGTTGGTGGT GCCGTGCTGT GCTCTCCAGG
CAATCGGGAA CGCGCTCCAC ATCCTCCCCA ACAAGAAGCA GCCGATGACC GTCCTCCATG ACGTCAGCGG GATCATCAAG
CCCCGGAGGT AAAAACCCAT AACACAGCCA GCCATGCATC ATCTTCTTCT GCGTGTACCA GTGCATCATG ATTCATGGCG
CTCGCGCTAA CGCATCCATC CATGGTGGTG CTCTCTGTGT AGGATGACCT TGCTGCTGGG ACCTCCTGGC TCGGGCAAGA
CCACGTTGCT CCTGGCGTTG GCAGGGAAGC TCGACAAGGA CCTCAAGGTC TCGGGGAAGG TGACCTACAA TGGACACGGG
ATGCACGAGT TCGTCCCGGA AAGGACCGCG GCGTACATCA GCCAGCATGA TCTCCACATC GGGGAGATGA CCGTGAGGGA
GACATTGGCC TTCTCGGCGC GGTGCCAAGG CGTTGGCACT AGATATGGTA TGAACCTGAA TGCCAAGATT ACATGATACT
CCTACCATCT AATGCTTATT GACGCCTTTG ACATGAGTAC TGAGGTTTGC TGTTTTTGCT TTGTTTAGAA ATGCTGACTG
AGTTGGCAAG AAGGGAAAAG GCAGCAAACA TCAAGCCAGA TCATGATATT GATATCTACA TGAAGGTGAT GATGCTATCA
CATAAGAGTG TTCTAGTTTT TTTTTCTCTC TCTTGGAATT GTATATGTAA CCAGGATTGC ATTGGCGAAT CATTTCAACA
GGACATGTGA TATATACTAT ACATGTCTAC TAGCAATGTA AGTAACACCT TTTATATTTC ATACATGTAG GCCTCAGCTA
TGGGAGGACA AGAATCTAGT GTTGTTACGG ACTACATATT GAAGGTACAG TCTGCTAGCT GTGGATTAAA CCGTAGTACT
ACAAATATGA TTTCTTGTGG CATTTGTGTA TGGATAATAT CTCATTCCTG CTTCTCTGCT ACATAAATGC AGATATTAGG
ATTGGATATT TGTGCTGATA CGGTAGTAGG AAATGAGATG TTAAGGGGTA TATCTGGTGG ACAACGGAAG CGTGTCACAA
CAGGTATGAC TAACAGTCTT TAGCAAGATG GGGGTTGTTC TTTAAAGAAA AACTCTAACT GTCCTATATG TTCACAGGTG
AAATGCTTGT TGGTCCAGCA AGAGCTTTGT TCATGGATGA GATATCCACT GGACTGGACA GCTCAACCAC GTACCAGATC
GTGAATTCCC TTAGGCAGAC TATCCACATC CTTGGCGGAA CTGCTGTCAT CTCATTGCTC CAGCCAGCAC CTGAAACATA
CAACTTGTTT GATGACATTA TACTCCTCTC TGACGGGCAG GTTGTGTACC AGGGTCCCCG TGAACATGTG CTTGAGTTCT
TTGAGTTCAT GGGCTTCAGA TGCCCTGCCA GAAAGGGTGT TGCTGATTTC TTGCAGGAGG TATGTGCTGT TTATCATCTG
TAAAAATTCA TGCCATTTAC TGCACAAGGT TTTCAAAATA GACAGTACTG ATATCTCTGA ATTTGTTGAA AAAGGTGACA
TCAAGGAAAG ATCAGGGGCA GTACTGGTGT AGGCGTGACA GACCATACCG TTTTGTGCCA GTGAAGCAAT TCGCAGATGC
GTTCCGTTCC TTCCATGTGG GCCGATCCAT ACAGAATGAG CTTTCTGAGC CATTTGATAG GACCAGGAGC CACCCTGCTG
CTCTGGCTAC TTCAAAGTAT GGTGTCAGCA GGAAGGAGTT GCTCAAAGCC ACTATCGATA GAGAGCTTCT TCTCATGAAG
AGGAATGCAT TTATGTACAT TTTTAAAGCT GTTAATGTAA GTTCATATCT CTGGTGCACT AATTTTGATT CAAGATATCG
ATCGATCGAT CTGATCATCT GAAACTTTCT TTCATTGCAG CTAACTCTAA TGGCATTGAT CGTGATGACC ACATTTTTCC
GTACCAGCAT GCGACATGAT AGAGATTATG GAATGATCTA TCTGGGGGCA TTGTACTTTG CTCTTGACAC AGTCATGTTT
AATGGTTTCG CAGAGCTTGC CATGACTGTC ATGAAACTAC CTGTTTTCTT CAAGCAAAGG GATCTTCTCT TCTTTCCTGC
ATGGGCCTAC ACCATACCAT CATGGATTCT TCAGATTCCT ATCACATTTC TCGAAGTTGG TGTTTATGTT TTCATAACAT
ACTATGTCAT TGGATTTGAT CCCAGTGTAA GCAGGTAAGA TGCATTGATG CAGATATCTA CATGCCTAAA AGAATCCAAG
AAATAAGCTT ATTTTGTATG CAGATATCTA TTATTTTGCA AGGTGTTGCC TAGTATATTG ATAGAAATGT TCCACAATAA
ATGAGTCTAT TCTGTGAAGT CTGAAACTCT GAATAACTTT TTGTGCATAG GTTCTTCAAG CAGTATCTGC TGCTACTTGC
ACTCAACCAG ATGTCATCTG CACTATTCCG CTTCATTGCT GGAATCGGAA GAGACATGGT TGTGTCTCAC ACATTTGGAC
CCTTATCACT GTTGGCTTTT GCAGCATTGG GTGGCTTTAT CCTTGCAAGA CGTAAGTTAC TGGATTCCCT TTCAATAATT
GCATGTTCTT ATATGTACTT GAAATTGATG GTTTTAAATG CTAATTGTTC CTGACATGTT TCTCTTTTAT AGCTGACGTG
AAGAAATGGT GGATTTGGGG TTACTGGATA TCCCCGCTAT CGTATGCACA AAATGCTATT TCGACAAATG AATTTTTGGG
TCACAGTTGG AGCCAAGTTA GTGCCACATT TCTTCACCAG CAATTGAACT TGCAATGTTA TAAACTGTAA AACTGAACAT
GTATTTTGCA TGTCACAGAT ACTTCCTGGA GAAAATGTGA CCTTGGGAGT TAGTGTACTA AAATCTCGTG GTATCTTTAC
TGAAGCTAAG TGGTACTGGA TTGGACTTGG TGCTTTGCTT GGATACACTC TCCTCTTTAA CCTGCTCTAC ACTGTAGCTC
TTTCAGTTTT GAGTCGTAAG TATATTTGAA AGACATTTTT TAGAACTCCA AAATATCTAA TCAACATTTG CGAGCTAAAA
GATAATAACT GTGGCTACTT GAATTTTTTT CGCAGCATTC ACTGACTCTC ATGCATCAAT GTCTGAGGAC GCATTGAAAG
AGAAGCATGC CAACTTAACC GGTGAAGTTG TAGAGGGACA GAAGGACACT AAATCTAGGA AGCAGGAATT GGAATTGTCC
CATATTGCTG ACCAAAACTC TGGAATTAAC AGCGCTGATT CTAGCGCAAG CAGGAAGGGA ATGGTGCTCC CATTTGCACC
ACTATCTATT AGTTTTAACG ACGTAAGATA CTCAGTGGAC ATGCCAGAGG TAATTTTGCT CAGAACGACT ACAAGTGCGT
AAAAATCATT ATGTTAACAC AGGTTTTTAA CCCAATTATG TTGTTTTATA TTAACAGGCA ATGAAAGCAC AAGGCATAAC
AGAAGACCGT TTGTTGCTTC TAAAGGGTGT TAGTGGTTCT TTCAGGCCAG GTGTACTTAC TGCATTGATG GGTGTAAGTG
GTGCCGGGAA GACAACACTG ATGGATGTTT TAGCAGGGAG AAAAACTGGA GGATACATAG AGGGAGATAT TAGAATATCT
GGCTATCCAA AGAAGCAAGA GACCTTTGCA CGTATATCAG GATATTGTGA GCAAAATGAC ATCCATTCTC CCCATGTGAC
AGTATATGAA TCACTTGTGT TCTCTGCATG GCTGCGGCTA CCCTCGGAGG TTGATTCAGA AGCAAGAAAG GTTAGTTAGC
TAGATTATGG GCTAACATTT GTTTCTTGTG TATGTTTTTC GGTTGTTAAC TGACTGTACA TCTTACGCGC TGAACCATGA
TTACAGATGT TTATTGAGGA GGTCATGGAT CTTGTAGAGC TCACATCTCT GAGGGGAGCA CTTGTTGGGC TTCCTGGAGT
GAGCGGCCTG TCAACTGAGC AACGCAAGAG ACTTACTATT GCTGTGGAGC TTGTTGCAAA CCCTTCAATT ATTTTTATGG
ATGAGCCAAC ATCTGGTCTT GATGCTCGGG CAGCTGCGAT TGTGATGAGG ACCGTAAGGA ACACCGTTAA CACTGGCAGG
ACTGTTGTTT GTACCATTCA CCAGCCAAGT ATTGACATCT TTGAAGCATT TGATGAGGTG ACTAGTTGTT TCTTTGGGAA
GTTATCCTTT GATTCATTAG ATGAACTCTG TATATTAACT ACGTTGCTGT TCACCTTATC TACAGCTTTT CCTAATGAAG
AGAGGAGGTG AAGAGATATA TGTTGGTCCA GTGGGCCAGA ATTCCTCAAA ACTGATTGAG TACTTTGAGG TAAGAACGGA
AAATCAACAT AAATAACAAT CATCTCTTCA TGCTTCAGCA CGTAGGCTGA CTAAGTCACA TCAAACGGAA ATTCCGTTGT
TCATTTGTTC AGGGAATTGA TGGCGTTAGT AGGATAAAAG ATGGATATAA TCCAGCAACA TGGATGTTGG AAGTGACCTC
TTCAGCCCAG GAGGAGATGC TCGGTGTTGA TTTTAGTGAA ATCTACAGGC AGTCAGAGCT ATATCAGTAA GCTTCGGCAC
ATGCCATTCT GATTAATAGA ATGAATAGTG TATTTGAACT GCAATTCTAA TTATTATTAT TATTATTTTG CATATTTGCA
ATTTCAGAAG GAACAAGGAA CTTATTGAGG AGCTAAGCAC ACCACCTCCT GGCTCTACTG ATCTCAACTT CCCTACGCAG
TACTCTAGAT CGTTCATTAC ACAGTGCCTA GCTTGCTTGT GGAAGCAGAA TTGGTCATAT TGGAGGAATC CATCCTACAC
TGCAGTGAGA TTACTCTTCA CTATCGTCAT TGCCCTAATG TTTGGAACAA TGTTCTGGAA CCTTGGAACG AGAACGTACG
TCTCTAACAT ATGTTCTTAT TATTTTAATC TGTTTGACAA ATAACTTCTA AACCTTTACT CATCATATCT TGTTGCAGTA
AAAAACAACA GGATCTATTC AATGCCATGG GATCAATGTA TGCTGCAGTT CTCTACATTG GAGTGCAAAA CTCTGGTTCT
GTTCAACCAG TGGTGGTGGT GGAGCGAACA GTCTTTTACC GAGAAAGAGC AGCTGGCATG TATTCAGCTT TCCCGTATGC
ATTTGGACAG GTAATTTGTC TTTTAGACTC TCGGTTGGCC TAGTTCTAAT CTCATGTATA TAATGTATGA CTTCAAAGAC
TCTGATGCCT GAATTCTGAC TTGCATTTGG GATTGAACTG AAATGGCTGT GCAATAAGCT ATTCGTTAGC ACTGTCAAGC
TCTTTTGGTC CCATAACCTA ACAATGCCAC TTTTCCCTTT TTAGGTTGCA ATTGAGTTAC CATACATCAT GGTTCAGACT
CTGATATATG GCGTGCTGGT ATACTCAATG ATTGGATTTG AGTGGACTGT TGCCAAGTTC TTGTGGTACT TGTTCTTCAT
GTACTTCACA CTGCTATATT TCACATTTTA CGGAATGATG GCGGTAGGGT TGACACCAAA TGAGAGCATA GCAGCAATCA
TCTCGTCCGC TTTCTACAAT GTGTGGAACC TCTTCTCAGG ATATCTGATC CCTCGACCGG TAGGTTATTC TCCCATCTCA
ATTTCGCCCC CTTTCTTTTC TCATGAAATG TCGCTTTTAT TAGTCCTTTA GAACCGTTTT AAATTTCTCT ACAGAAAATC
CCTGTTTGGT GGAGGTGGTA CTGTTGGATT TGCCCGGTTG CATGGACTTT GTATGGATTA GTTGCTTCCC AGTTTGGTGA
TATCCAACAT GTGCTCGAAG GCGACACCAG AACTGTTGCA CAGTTTGTCA CTGATTACTT TGGCTTCCAT CATAACTTCC
TGTGGGTGGT GGCCGTGGTG CACGTCGTCT TCGCCGTGAC CTTCGCCTTC CTCTTCAGTT TTGCGATCAT GAAGTTCAAC
TTCCAGAGGA GATGAGAAAG TGATCATTCT TTTTTGCATT CGTTCTATTG TACTACTGAA TAGCTATTAG CTATCCTGTA
AATGGTATAG AGATCATCTT CTAGTATTTC ATTATTTCAA GCATGTAAAA ATTCGGACAT CTAGTAGGAT TCTCTAGGAA
AAAGAACCCT TGTTGAGCTT CCTGCCTCTT GACCAGCTCT AGCTGATAAA TGTCGGATGC AGATGAATGT AAAGTATGGC
CTTCAATGTT TTCATTTTTG TCGAATTAAT GAAAGCAGAA AATTTGTTGA TTC

Locus: Os01g0609900

Loading...

Locus: Os01g0609900

Loading...