Os01t0612600-01

Locus

Os01g0612600

Description

Protein of unknown function DUF1644 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

DUF1644 family protein

Transcript Evidence

AK066561 (DDBJ, Best hit)

AK062906 (DDBJ, Best hit)

Protein Evidence

B8ABU8 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Protein of unknown function DUF1644 (IPR012866)

Full-length cDNA

J013073D14 (Online Clone Ordering)

001-108-F10 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0612600-01)

RiceXPro (AK066561)

Others

Oryzabase (19991)

KEGG (Os01t0612600-01)

Transcript

2396 bp

>Os01t0612600-01 Protein of unknown function DUF1644 family protein.
CTCTCTCTCGAGTCTCCCGTCTCCTTTCCCCTCCTTCCTCCTCCCCTTTCGTCTTAGCCT
CAGCTCGCCGCGAGACGAATCCTCCCCTCGCCGCCGCCGGGTCCGATCGACGGCGGTATC
GAGGGACGGAGGGGGCGCGCCCGTTCTCTCGCCGTACACCGTCGTCGCCGACCGGCTCCC
TCGACGGCACGGTAAAATAAAAAATAAAAAGCCTCCTCCTCCTCCTCCTCCCCTATGATG
GCGGATGCGGCGGCGGGGGGGCGGGCCGATCTGGACGCCGTTGACCCGCCCGATTCGGCT
CGGTCGCATCCCCCCGTGCGCGCGTTTACTGGGAGGATCTGTTGTATTTGGACGTTTTAG
ACTGGATCGAGTGAGGGGGATTTTGCGGTGTTCTTGCTGTGACGGGATTCAGCTATGTAG
GTGTAGGAATCTTATGTTAACTTGTTGGGTGGCTCTGCTGCTTCTGATTCTTTCTGTGAA
TCTGGAGTAACAAATTCTTTCTGTGAATCTGGAGTAACAAGGACTTGTGCTATGGCCGAT
CTCTACTTTTAGTACTTCGTTATGTTCTATACGGCATAGGAGTCCATCTCTCGATAGATA
AGAGTTCTCTGATTTTGGATGGGGATTTGCTTGATGGATCCGGAGTCATATAACATGTTT
GCAAAAAAAGAAAAAGGAGGAGTCCATCTCTCGATAGATAAGAGTTCTCTGATTTTGGAT
GGGGATTTGCTTGATGGATCCGGAGTCATATAACATGTTTGCAAAAAAAGAAAAAGGAAA
AATGATTTAGTTTGTGTTCTGTCATGTATAACCCTTGTTTCTACAAAGATGTACTAGTTT
GCGATCTGATTAAGCATCTCATGCTTTCTCGCTTTGATTCTCTTTCAGAGTTTGAAGTTG
GAAATCAACCTTGTTGTTCTCTGTAGCGCTTTCCTTTGGATTGCGGAGAATTTCAAACAA
AACCAACAAACCTTTGCATCTGACTGACTTGAGGTAACTATGCCAAAGGACAGGAGCACC
CGTGCCGTGTCATACGAGCGCCGCCGGTCTCGTGTTTCGCCGTACCCCTCCAATGGGAAG
GGCTGTGCTCGCAGGTCAGAGGAGTCTGCTGCTGCTGCCGCTGCCGCTGCCGCGAAGCAG
GCTGCGGAATGGGAGGATGTCCGCTGCCCGGTCTGCATGGATCACCCACACAACGCTGTT
CTGCTCGTCTGCTCGTCGCATGAGAAGGGCTGCCGCCCTTTCATGTGCGACACAAGCTAC
CGACACTCCAATTGCTTTGATCAGTACCGCAAGGCCTCTAAGGAGTCCTCAAAGGATTCT
GGTGCCAGTGCTGCTGCTGCGCCAGAATGCAGCGAGTGCCAGCAGCCCATAAAACTGTCT
TGCCCGTTGTGTCGTGGGCCAGTCAGCCATTGGACAAAGGATTATGATGCACGGAAGTAC
TTGAACGTGAAGGTTCGAGCATGTACTAAAGAGTCCTGCGAGTTCAGGGGGGCATACGGT
CAACTGAGGAGACACGCCAGGGAGAACCATCCTACTGTTAGACCAACTCAGGTGGATCCT
GAACGGCAGCGAGACTGGCACAGAATGGAGCAGCAGCGTGATCTTGGGGACTTGTTCAGC
ATGCTTCGTTCAGGCTTAAGTGCCAGGGAGGACGGGATCGGAGTCAGTGAAGGGGAAGAG
GATATCAGCGAGAGGGCTCTACATAGCCCATCTATAACAATGGTCTTCATTGTGCGCACT
GGCAGGTCGATACTCCACTACAGGGAAGCATTCCCAGGCCACCACAGAAGAAGAACAATT
CTTCTGCTTGGGGAGGCTTTTGGTCGTGAATCCTCCCCATTAGGGGGAGCAAGTGGCAGT
GGTGATGGTGACACCACAGCTCGCGAAAATGATGAAGGTGATGACGACGTCACGCTATCA
ACAGAGGCATCGGCTGGTTCTCAGCATGATGGTGAAGTCGATGGTGATCCTGCACATTGA
TGCAGCTGGTAGGGAGTGCCAAGGCGTGCACCTGGACTGAAAAGCTCTACAAGCAAGCAA
TCTTTCGGGTTCACCAGGCATCCAAGACCACATGTTGGGAAGAAACATGGGGGTGTTCCA
TTTGGCTTTAGGCGTAGTCAGGACATCCTGCCTACGTGCAAGAAGAACTGAGATGAAATT
GCAATGCAGGGATAGGCTCAAAACCGCTGTGGAGTTGTCTTAGTTTCATTTTTAATATAT
TTGCTGGAAGGTCTGTAGCAAACAGAAACATCAATGGTGGTGGTGTATTTATCATGTCCA
CGGCTAGGACTTGGGTGAATTCAATTCACTGCGTTGTAATTTGATCTCTGAAATATATTC
TTTCTGCGTTGATGAATCTGATCATGTTAAAGCAGAAATTTGATGTATATTTATGT

CDS

981 bp

>Os01t0612600-01 Protein of unknown function DUF1644 family protein.
ATGCCAAAGGACAGGAGCACCCGTGCCGTGTCATACGAGCGCCGCCGGTCTCGTGTTTCG
CCGTACCCCTCCAATGGGAAGGGCTGTGCTCGCAGGTCAGAGGAGTCTGCTGCTGCTGCC
GCTGCCGCTGCCGCGAAGCAGGCTGCGGAATGGGAGGATGTCCGCTGCCCGGTCTGCATG
GATCACCCACACAACGCTGTTCTGCTCGTCTGCTCGTCGCATGAGAAGGGCTGCCGCCCT
TTCATGTGCGACACAAGCTACCGACACTCCAATTGCTTTGATCAGTACCGCAAGGCCTCT
AAGGAGTCCTCAAAGGATTCTGGTGCCAGTGCTGCTGCTGCGCCAGAATGCAGCGAGTGC
CAGCAGCCCATAAAACTGTCTTGCCCGTTGTGTCGTGGGCCAGTCAGCCATTGGACAAAG
GATTATGATGCACGGAAGTACTTGAACGTGAAGGTTCGAGCATGTACTAAAGAGTCCTGC
GAGTTCAGGGGGGCATACGGTCAACTGAGGAGACACGCCAGGGAGAACCATCCTACTGTT
AGACCAACTCAGGTGGATCCTGAACGGCAGCGAGACTGGCACAGAATGGAGCAGCAGCGT
GATCTTGGGGACTTGTTCAGCATGCTTCGTTCAGGCTTAAGTGCCAGGGAGGACGGGATC
GGAGTCAGTGAAGGGGAAGAGGATATCAGCGAGAGGGCTCTACATAGCCCATCTATAACA
ATGGTCTTCATTGTGCGCACTGGCAGGTCGATACTCCACTACAGGGAAGCATTCCCAGGC
CACCACAGAAGAAGAACAATTCTTCTGCTTGGGGAGGCTTTTGGTCGTGAATCCTCCCCA
TTAGGGGGAGCAAGTGGCAGTGGTGATGGTGACACCACAGCTCGCGAAAATGATGAAGGT
GATGACGACGTCACGCTATCAACAGAGGCATCGGCTGGTTCTCAGCATGATGGTGAAGTC
GATGGTGATCCTGCACATTGA

Protein

327 aa

>Os01t0612600-01 Protein of unknown function DUF1644 family protein.
MPKDRSTRAVSYERRRSRVSPYPSNGKGCARRSEESAAAAAAAAAKQAAEWEDVRCPVCM
DHPHNAVLLVCSSHEKGCRPFMCDTSYRHSNCFDQYRKASKESSKDSGASAAAAPECSEC
QQPIKLSCPLCRGPVSHWTKDYDARKYLNVKVRACTKESCEFRGAYGQLRRHARENHPTV
RPTQVDPERQRDWHRMEQQRDLGDLFSMLRSGLSAREDGIGVSEGEEDISERALHSPSIT
MVFIVRTGRSILHYREAFPGHHRRRTILLLGEAFGRESSPLGGASGSGDGDTTARENDEG
DDDVTLSTEASAGSQHDGEVDGDPAH*

5'UTR

chr01:24284308..24285306 (- strand) : 999 bp

CDS

chr01:24283327..24284307 (- strand) : 981 bp

3'UTR

chr01:24282911..24283326 (- strand) : 416 bp

FASTA

>Os01t0612600-01 class=Sequence position=chr01:24282911..24285306 (- strand)
CTCTCTCTCG AGTCTCCCGT CTCCTTTCCC CTCCTTCCTC CTCCCCTTTC GTCTTAGCCT CAGCTCGCCG CGAGACGAAT
CCTCCCCTCG CCGCCGCCGG GTCCGATCGA CGGCGGTATC GAGGGACGGA GGGGGCGCGC CCGTTCTCTC GCCGTACACC
GTCGTCGCCG ACCGGCTCCC TCGACGGCAC GGTAAAATAA AAAATAAAAA GCCTCCTCCT CCTCCTCCTC CCCTATGATG
GCGGATGCGG CGGCGGGGGG GCGGGCCGAT CTGGACGCCG TTGACCCGCC CGATTCGGCT CGGTCGCATC CCCCCGTGCG
CGCGTTTACT GGGAGGATCT GTTGTATTTG GACGTTTTAG ACTGGATCGA GTGAGGGGGA TTTTGCGGTG TTCTTGCTGT
GACGGGATTC AGCTATGTAG GTGTAGGAAT CTTATGTTAA CTTGTTGGGT GGCTCTGCTG CTTCTGATTC TTTCTGTGAA
TCTGGAGTAA CAAATTCTTT CTGTGAATCT GGAGTAACAA GGACTTGTGC TATGGCCGAT CTCTACTTTT AGTACTTCGT
TATGTTCTAT ACGGCATAGG AGTCCATCTC TCGATAGATA AGAGTTCTCT GATTTTGGAT GGGGATTTGC TTGATGGATC
CGGAGTCATA TAACATGTTT GCAAAAAAAG AAAAAGGAGG AGTCCATCTC TCGATAGATA AGAGTTCTCT GATTTTGGAT
GGGGATTTGC TTGATGGATC CGGAGTCATA TAACATGTTT GCAAAAAAAG AAAAAGGAAA AATGATTTAG TTTGTGTTCT
GTCATGTATA ACCCTTGTTT CTACAAAGAT GTACTAGTTT GCGATCTGAT TAAGCATCTC ATGCTTTCTC GCTTTGATTC
TCTTTCAGAG TTTGAAGTTG GAAATCAACC TTGTTGTTCT CTGTAGCGCT TTCCTTTGGA TTGCGGAGAA TTTCAAACAA
AACCAACAAA CCTTTGCATC TGACTGACTT GAGGTAACTA TGCCAAAGGA CAGGAGCACC CGTGCCGTGT CATACGAGCG
CCGCCGGTCT CGTGTTTCGC CGTACCCCTC CAATGGGAAG GGCTGTGCTC GCAGGTCAGA GGAGTCTGCT GCTGCTGCCG
CTGCCGCTGC CGCGAAGCAG GCTGCGGAAT GGGAGGATGT CCGCTGCCCG GTCTGCATGG ATCACCCACA CAACGCTGTT
CTGCTCGTCT GCTCGTCGCA TGAGAAGGGC TGCCGCCCTT TCATGTGCGA CACAAGCTAC CGACACTCCA ATTGCTTTGA
TCAGTACCGC AAGGCCTCTA AGGAGTCCTC AAAGGATTCT GGTGCCAGTG CTGCTGCTGC GCCAGAATGC AGCGAGTGCC
AGCAGCCCAT AAAACTGTCT TGCCCGTTGT GTCGTGGGCC AGTCAGCCAT TGGACAAAGG ATTATGATGC ACGGAAGTAC
TTGAACGTGA AGGTTCGAGC ATGTACTAAA GAGTCCTGCG AGTTCAGGGG GGCATACGGT CAACTGAGGA GACACGCCAG
GGAGAACCAT CCTACTGTTA GACCAACTCA GGTGGATCCT GAACGGCAGC GAGACTGGCA CAGAATGGAG CAGCAGCGTG
ATCTTGGGGA CTTGTTCAGC ATGCTTCGTT CAGGCTTAAG TGCCAGGGAG GACGGGATCG GAGTCAGTGA AGGGGAAGAG
GATATCAGCG AGAGGGCTCT ACATAGCCCA TCTATAACAA TGGTCTTCAT TGTGCGCACT GGCAGGTCGA TACTCCACTA
CAGGGAAGCA TTCCCAGGCC ACCACAGAAG AAGAACAATT CTTCTGCTTG GGGAGGCTTT TGGTCGTGAA TCCTCCCCAT
TAGGGGGAGC AAGTGGCAGT GGTGATGGTG ACACCACAGC TCGCGAAAAT GATGAAGGTG ATGACGACGT CACGCTATCA
ACAGAGGCAT CGGCTGGTTC TCAGCATGAT GGTGAAGTCG ATGGTGATCC TGCACATTGA TGCAGCTGGT AGGGAGTGCC
AAGGCGTGCA CCTGGACTGA AAAGCTCTAC AAGCAAGCAA TCTTTCGGGT TCACCAGGCA TCCAAGACCA CATGTTGGGA
AGAAACATGG GGGTGTTCCA TTTGGCTTTA GGCGTAGTCA GGACATCCTG CCTACGTGCA AGAAGAACTG AGATGAAATT
GCAATGCAGG GATAGGCTCA AAACCGCTGT GGAGTTGTCT TAGTTTCATT TTTAATATAT TTGCTGGAAG GTCTGTAGCA
AACAGAAACA TCAATGGTGG TGGTGTATTT ATCATGTCCA CGGCTAGGAC TTGGGTGAAT TCAATTCACT GCGTTGTAAT
TTGATCTCTG AAATATATTC TTTCTGCGTT GATGAATCTG ATCATGTTAA AGCAGAAATT TGATGTATAT TTATGT

Locus: Os01g0612600

Loading...

Locus: Os01g0612600

Loading...