Os01t0612700-01

Locus

Os01g0612700

Description

Zinc finger, LSD1-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

LOL2

CGSNL Gene Name

LSD1-LIKE ZINC FINGER PROTEIN

Oryzabase Gene Symbol Synonym(s)

OsLOL2, OsLSD5, OsLOL5, LOL5

Oryzabase Gene Name Synonym(s)

LSD1-like 2, lsd one like 2, LSD1-like-5

Transcript Evidence

AK065375 (DDBJ, Best hit)

Protein Evidence

A2ZVC5 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Zinc finger, LSD1-type (IPR005735)

Full-length cDNA

J013008L21 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0612700-01)

Others

Oryzabase (7293)

Transcript

2968 bp

>Os01t0612700-01 Zinc finger, LSD1-type domain containing protein.
CAGCAGCCAGTGTGTCTCCAGTATTGGACAGTGGGGATCCAGATGCAGCTGAGGTTGATG
TAGTAGTAGGGATGCAAGAACAAGCTGCTGGTTCAGCGCTTGCCATGTTGGTAACTTACG
GGGAGACTGATACCTCAGCAGTCAGTGTATCTCCAGTACTGGAGAGTGGGGAGCCAGATG
CAGCCCAGATTGATGTAGTAGCAGGGATGCAAGAAGAAGCTCCTGGTTCAATGTTGGCCA
TGGAGGTAACGTACAGGGAGGTTGATGCTGCAACAGTCAGTGTGTCTCCGGTATTGGAGA
GTGTGGAGCCAGATGCAGCCAAGATCGATGTAGTAGCAAGGATGCAAGAAGAAGCTCCTG
GTTCAAAGCTTGCCATGGAGGTAATGTACGGGGAGACTGGTACCGCAGCAGTCAGTGTGC
CTCTGGTATTGGAGAGTAGGGAAGAGGGGTCACTTCAAGAATCAATGCAGAGACCATCTT
CTCCCACAATGAACATTGAGCAAGAGTCAATGCAGAGACCATTTTCTCCCACAATTGGCA
CTGAGACAAGTTCGCCAGAGATGGCTCCTGCTGGATCTGAGAACTGTAAAGTATCATGGT
TGCCGTTGCCCCCTCCTACACCACTTGGCGAATCAATGCCCTCCTTGCCAGTCGCAGCTG
CCCCCAAGGTTTTATTGGTGATGCCGGAGGAAGCGGTTGAGTCAGTCCCTTCATCGGAAG
CTCTGGATGTTGAAAAACCTGCCTCCATCACACAGGCTGAGCCCAGCTCACCTAATACGC
CACCGCCAGGATTTGAGAATTTTAAGTCGTCATGGTTGCCGCTACCCACGACTCCTCCCC
CAGTTGAAACCACTGATGTCTTGCCAGATGTGGTGGTTACCAAGGCAGTGGAAGCACCCA
TTGAGGAAGTGTCTAGGCCATTGCCAGCTTTGGAGGTGACAAACATGGAGTCAGACACTG
TCCTCAGTATCTTGCCCACAACAGTCTTGCCAACAGAAGGGACTGAGGGACTACTGCAAC
AACCACTATTGAGACCCCCTTCTCCAGTGGTGCAATCTGAACCATGTTTGCAAAATGAGA
TGGCACCTCCAGGGTTCGAGAATTTTAAGTCATCATCTGAACCATGTTCAGCAGAGGAGA
TAGCACCTCCAGGGTCCGATAATTTCAAATCATCATCTGAACCATGTTTACCAGAGGAGA
TGGCACCTCCAGGGTTTGAAAATTTTAAGTCATCATCTGAACCATGTTCACAAGAGGAGA
TGGCACCTCCAGGGTTTGAGAATTTTAAGTCATCATGGCCACCACTTCCCACTCTGCCCC
AAACTGTACCAGATGCAGCCGCAGCGGATGCTTTGGCAGCAACAGTGGAAGAAGCAGCTG
GGCCACCACCTGCATTGGAGTTGGAGGCAATGGATGTGGACATGGATGCCATACATCCAC
CACCGCTGCCTTTTGACAGTGGAGTGGAGTCATTGCAAAAGCCACTGCCAAGAGCACCTT
CTCCCATAATGCAAGAAGCGCCCTGTTCACCAGATAGGGCACCGCCAGGGTTTGAAACCT
ATAAGTCATCACAGTTACTGCTACCATCTCCATCTCTGGCACAAACCACAAATGTGCGAC
AAGATCAATCGGTAACTGAACCTGTGTCTGTGATAGAGGAAGCCCCTCAGCTACTGCACT
CAGTGGAGGTAATGGGTGTACATATGGATGCAGTACCTCCATTGCTACCATCATCTGAAA
GTGGAGCAGATGGGCTATCTCCGCAGCAATTCGCGCAACCTCCTCCTGCAGAAAAGGATA
CAACAACCTGTTTGCCAGATATGGTGCATTCAGGATGTGACAATTCAGAGCCCTCTCAGC
TTCTGTCACTGCCTGCTGTTATTTCTCCAGTTCAGACCCCAGATGGCTTGGCTGATGTTC
CTGCCATTGACAGGGTTGCAGTGGCATTGGAAGAATCGCCTCAGCGACCGCTTGTATCAG
GGGAAATGGAAGCTGGCACAGTGCCCATTCGGTCATCACCACTGAAGAATATTTCTGAGG
GGTCACTGCCACAACTAGAATCAGAGTCACATTCTCCTACATCACAGGCTGCAGATAGCT
TACTAGATGCATCTGACTCAAAGTCTGTGGCTGTGGCCTCAGAGGAGATGTCTCAGCTAC
CACTTGCATCGCAGGCAACTACTACAGACCTTGTCAGTACAACTGCAATGCAGCCACAAT
CTGAGGGTATAGTGGATGAGTCATTGCAGCCTCAGCATCCACCCTCTTCTACCGCACATG
ATTCACCTTGTTTACAGGACTCTGTGCCATTGGTGCCACCACCACCTTCCCCTTACCTAA
ATAAAGAAGTAGGTCAAATGGTATGTGGAAGCTGCCGTATTCTTCTTGCTTATTTTAGAG
GTGCTGGTTATGTTCACTGTACTTGTTGCCAGACAATGAACTATGTATTGGAAGCTCATG
AAGTTGGTAAGGTGCATTGTGGACACTGTGCGACATTATTGATGTATCCTTTTGGTGCGC
CTGCTGTTAAGTGCTCGTTGTGCCTCTTTGTCACTGAAATTGGAGAGCGGAATGTTCGCC
GTCGGTTATCAATCGAGCAACCCACAAGAACTAACTCATCAGGGCTAGCTGAAGCCTGAT
CAGTTCTGGTCCCATGTACCCATCGGATTCCAAGAAAGCTTCAAATGCTAATGTGGATGA
AAGGAACAGAATGTTCGCCCTTCGTCATGAGGTGTGGGCATGAAAGTTCAAGATGGTATG
GACAAGCCAAAGTGTACAAAGATAGCGTTTTTTTTTTCATTGATGTAGACAGGAAAGGTG
ACCTTGTTAGTACGACTAGATCTCCTTTGAAAGGGAAAATAAAAGAAAAATAGTTCGATT
CAATCTGGAGGTGATATGCGTATGTCATATGAATGATAACAGAGTAGTTTTCAGATGGTT
CTTTCGCGGTGACCATCATGTTGCCCCC

CDS

2637 bp

>Os01t0612700-01 Zinc finger, LSD1-type domain containing protein.
GCAGCCAGTGTGTCTCCAGTATTGGACAGTGGGGATCCAGATGCAGCTGAGGTTGATGTA
GTAGTAGGGATGCAAGAACAAGCTGCTGGTTCAGCGCTTGCCATGTTGGTAACTTACGGG
GAGACTGATACCTCAGCAGTCAGTGTATCTCCAGTACTGGAGAGTGGGGAGCCAGATGCA
GCCCAGATTGATGTAGTAGCAGGGATGCAAGAAGAAGCTCCTGGTTCAATGTTGGCCATG
GAGGTAACGTACAGGGAGGTTGATGCTGCAACAGTCAGTGTGTCTCCGGTATTGGAGAGT
GTGGAGCCAGATGCAGCCAAGATCGATGTAGTAGCAAGGATGCAAGAAGAAGCTCCTGGT
TCAAAGCTTGCCATGGAGGTAATGTACGGGGAGACTGGTACCGCAGCAGTCAGTGTGCCT
CTGGTATTGGAGAGTAGGGAAGAGGGGTCACTTCAAGAATCAATGCAGAGACCATCTTCT
CCCACAATGAACATTGAGCAAGAGTCAATGCAGAGACCATTTTCTCCCACAATTGGCACT
GAGACAAGTTCGCCAGAGATGGCTCCTGCTGGATCTGAGAACTGTAAAGTATCATGGTTG
CCGTTGCCCCCTCCTACACCACTTGGCGAATCAATGCCCTCCTTGCCAGTCGCAGCTGCC
CCCAAGGTTTTATTGGTGATGCCGGAGGAAGCGGTTGAGTCAGTCCCTTCATCGGAAGCT
CTGGATGTTGAAAAACCTGCCTCCATCACACAGGCTGAGCCCAGCTCACCTAATACGCCA
CCGCCAGGATTTGAGAATTTTAAGTCGTCATGGTTGCCGCTACCCACGACTCCTCCCCCA
GTTGAAACCACTGATGTCTTGCCAGATGTGGTGGTTACCAAGGCAGTGGAAGCACCCATT
GAGGAAGTGTCTAGGCCATTGCCAGCTTTGGAGGTGACAAACATGGAGTCAGACACTGTC
CTCAGTATCTTGCCCACAACAGTCTTGCCAACAGAAGGGACTGAGGGACTACTGCAACAA
CCACTATTGAGACCCCCTTCTCCAGTGGTGCAATCTGAACCATGTTTGCAAAATGAGATG
GCACCTCCAGGGTTCGAGAATTTTAAGTCATCATCTGAACCATGTTCAGCAGAGGAGATA
GCACCTCCAGGGTCCGATAATTTCAAATCATCATCTGAACCATGTTTACCAGAGGAGATG
GCACCTCCAGGGTTTGAAAATTTTAAGTCATCATCTGAACCATGTTCACAAGAGGAGATG
GCACCTCCAGGGTTTGAGAATTTTAAGTCATCATGGCCACCACTTCCCACTCTGCCCCAA
ACTGTACCAGATGCAGCCGCAGCGGATGCTTTGGCAGCAACAGTGGAAGAAGCAGCTGGG
CCACCACCTGCATTGGAGTTGGAGGCAATGGATGTGGACATGGATGCCATACATCCACCA
CCGCTGCCTTTTGACAGTGGAGTGGAGTCATTGCAAAAGCCACTGCCAAGAGCACCTTCT
CCCATAATGCAAGAAGCGCCCTGTTCACCAGATAGGGCACCGCCAGGGTTTGAAACCTAT
AAGTCATCACAGTTACTGCTACCATCTCCATCTCTGGCACAAACCACAAATGTGCGACAA
GATCAATCGGTAACTGAACCTGTGTCTGTGATAGAGGAAGCCCCTCAGCTACTGCACTCA
GTGGAGGTAATGGGTGTACATATGGATGCAGTACCTCCATTGCTACCATCATCTGAAAGT
GGAGCAGATGGGCTATCTCCGCAGCAATTCGCGCAACCTCCTCCTGCAGAAAAGGATACA
ACAACCTGTTTGCCAGATATGGTGCATTCAGGATGTGACAATTCAGAGCCCTCTCAGCTT
CTGTCACTGCCTGCTGTTATTTCTCCAGTTCAGACCCCAGATGGCTTGGCTGATGTTCCT
GCCATTGACAGGGTTGCAGTGGCATTGGAAGAATCGCCTCAGCGACCGCTTGTATCAGGG
GAAATGGAAGCTGGCACAGTGCCCATTCGGTCATCACCACTGAAGAATATTTCTGAGGGG
TCACTGCCACAACTAGAATCAGAGTCACATTCTCCTACATCACAGGCTGCAGATAGCTTA
CTAGATGCATCTGACTCAAAGTCTGTGGCTGTGGCCTCAGAGGAGATGTCTCAGCTACCA
CTTGCATCGCAGGCAACTACTACAGACCTTGTCAGTACAACTGCAATGCAGCCACAATCT
GAGGGTATAGTGGATGAGTCATTGCAGCCTCAGCATCCACCCTCTTCTACCGCACATGAT
TCACCTTGTTTACAGGACTCTGTGCCATTGGTGCCACCACCACCTTCCCCTTACCTAAAT
AAAGAAGTAGGTCAAATGGTATGTGGAAGCTGCCGTATTCTTCTTGCTTATTTTAGAGGT
GCTGGTTATGTTCACTGTACTTGTTGCCAGACAATGAACTATGTATTGGAAGCTCATGAA
GTTGGTAAGGTGCATTGTGGACACTGTGCGACATTATTGATGTATCCTTTTGGTGCGCCT
GCTGTTAAGTGCTCGTTGTGCCTCTTTGTCACTGAAATTGGAGAGCGGAATGTTCGCCGT
CGGTTATCAATCGAGCAACCCACAAGAACTAACTCATCAGGGCTAGCTGAAGCCTGA

Protein

879 aa

>Os01t0612700-01 Zinc finger, LSD1-type domain containing protein.
AASVSPVLDSGDPDAAEVDVVVGMQEQAAGSALAMLVTYGETDTSAVSVSPVLESGEPDA
AQIDVVAGMQEEAPGSMLAMEVTYREVDAATVSVSPVLESVEPDAAKIDVVARMQEEAPG
SKLAMEVMYGETGTAAVSVPLVLESREEGSLQESMQRPSSPTMNIEQESMQRPFSPTIGT
ETSSPEMAPAGSENCKVSWLPLPPPTPLGESMPSLPVAAAPKVLLVMPEEAVESVPSSEA
LDVEKPASITQAEPSSPNTPPPGFENFKSSWLPLPTTPPPVETTDVLPDVVVTKAVEAPI
EEVSRPLPALEVTNMESDTVLSILPTTVLPTEGTEGLLQQPLLRPPSPVVQSEPCLQNEM
APPGFENFKSSSEPCSAEEIAPPGSDNFKSSSEPCLPEEMAPPGFENFKSSSEPCSQEEM
APPGFENFKSSWPPLPTLPQTVPDAAAADALAATVEEAAGPPPALELEAMDVDMDAIHPP
PLPFDSGVESLQKPLPRAPSPIMQEAPCSPDRAPPGFETYKSSQLLLPSPSLAQTTNVRQ
DQSVTEPVSVIEEAPQLLHSVEVMGVHMDAVPPLLPSSESGADGLSPQQFAQPPPAEKDT
TTCLPDMVHSGCDNSEPSQLLSLPAVISPVQTPDGLADVPAIDRVAVALEESPQRPLVSG
EMEAGTVPIRSSPLKNISEGSLPQLESESHSPTSQAADSLLDASDSKSVAVASEEMSQLP
LASQATTTDLVSTTAMQPQSEGIVDESLQPQHPPSSTAHDSPCLQDSVPLVPPPPSPYLN
KEVGQMVCGSCRILLAYFRGAGYVHCTCCQTMNYVLEAHEVGKVHCGHCATLLMYPFGAP
AVKCSLCLFVTEIGERNVRRRLSIEQPTRTNSSGLAEA*

5'UTR

chr01:24294290..24294291 (+ strand) : 2 bp

CDS

chr01:24294292..24296635 (+ strand) : 2344 bp

chr01:24297626..24297733 (+ strand) : 108 bp

chr01:24298222..24298331 (+ strand) : 110 bp

chr01:24299097..24299171 (+ strand) : 75 bp

3'UTR

chr01:24299172..24299500 (+ strand) : 329 bp

FASTA

>Os01t0612700-01 class=Sequence position=chr01:24294290..24299500 (+ strand)
CAGCAGCCAG TGTGTCTCCA GTATTGGACA GTGGGGATCC AGATGCAGCT GAGGTTGATG TAGTAGTAGG GATGCAAGAA
CAAGCTGCTG GTTCAGCGCT TGCCATGTTG GTAACTTACG GGGAGACTGA TACCTCAGCA GTCAGTGTAT CTCCAGTACT
GGAGAGTGGG GAGCCAGATG CAGCCCAGAT TGATGTAGTA GCAGGGATGC AAGAAGAAGC TCCTGGTTCA ATGTTGGCCA
TGGAGGTAAC GTACAGGGAG GTTGATGCTG CAACAGTCAG TGTGTCTCCG GTATTGGAGA GTGTGGAGCC AGATGCAGCC
AAGATCGATG TAGTAGCAAG GATGCAAGAA GAAGCTCCTG GTTCAAAGCT TGCCATGGAG GTAATGTACG GGGAGACTGG
TACCGCAGCA GTCAGTGTGC CTCTGGTATT GGAGAGTAGG GAAGAGGGGT CACTTCAAGA ATCAATGCAG AGACCATCTT
CTCCCACAAT GAACATTGAG CAAGAGTCAA TGCAGAGACC ATTTTCTCCC ACAATTGGCA CTGAGACAAG TTCGCCAGAG
ATGGCTCCTG CTGGATCTGA GAACTGTAAA GTATCATGGT TGCCGTTGCC CCCTCCTACA CCACTTGGCG AATCAATGCC
CTCCTTGCCA GTCGCAGCTG CCCCCAAGGT TTTATTGGTG ATGCCGGAGG AAGCGGTTGA GTCAGTCCCT TCATCGGAAG
CTCTGGATGT TGAAAAACCT GCCTCCATCA CACAGGCTGA GCCCAGCTCA CCTAATACGC CACCGCCAGG ATTTGAGAAT
TTTAAGTCGT CATGGTTGCC GCTACCCACG ACTCCTCCCC CAGTTGAAAC CACTGATGTC TTGCCAGATG TGGTGGTTAC
CAAGGCAGTG GAAGCACCCA TTGAGGAAGT GTCTAGGCCA TTGCCAGCTT TGGAGGTGAC AAACATGGAG TCAGACACTG
TCCTCAGTAT CTTGCCCACA ACAGTCTTGC CAACAGAAGG GACTGAGGGA CTACTGCAAC AACCACTATT GAGACCCCCT
TCTCCAGTGG TGCAATCTGA ACCATGTTTG CAAAATGAGA TGGCACCTCC AGGGTTCGAG AATTTTAAGT CATCATCTGA
ACCATGTTCA GCAGAGGAGA TAGCACCTCC AGGGTCCGAT AATTTCAAAT CATCATCTGA ACCATGTTTA CCAGAGGAGA
TGGCACCTCC AGGGTTTGAA AATTTTAAGT CATCATCTGA ACCATGTTCA CAAGAGGAGA TGGCACCTCC AGGGTTTGAG
AATTTTAAGT CATCATGGCC ACCACTTCCC ACTCTGCCCC AAACTGTACC AGATGCAGCC GCAGCGGATG CTTTGGCAGC
AACAGTGGAA GAAGCAGCTG GGCCACCACC TGCATTGGAG TTGGAGGCAA TGGATGTGGA CATGGATGCC ATACATCCAC
CACCGCTGCC TTTTGACAGT GGAGTGGAGT CATTGCAAAA GCCACTGCCA AGAGCACCTT CTCCCATAAT GCAAGAAGCG
CCCTGTTCAC CAGATAGGGC ACCGCCAGGG TTTGAAACCT ATAAGTCATC ACAGTTACTG CTACCATCTC CATCTCTGGC
ACAAACCACA AATGTGCGAC AAGATCAATC GGTAACTGAA CCTGTGTCTG TGATAGAGGA AGCCCCTCAG CTACTGCACT
CAGTGGAGGT AATGGGTGTA CATATGGATG CAGTACCTCC ATTGCTACCA TCATCTGAAA GTGGAGCAGA TGGGCTATCT
CCGCAGCAAT TCGCGCAACC TCCTCCTGCA GAAAAGGATA CAACAACCTG TTTGCCAGAT ATGGTGCATT CAGGATGTGA
CAATTCAGAG CCCTCTCAGC TTCTGTCACT GCCTGCTGTT ATTTCTCCAG TTCAGACCCC AGATGGCTTG GCTGATGTTC
CTGCCATTGA CAGGGTTGCA GTGGCATTGG AAGAATCGCC TCAGCGACCG CTTGTATCAG GGGAAATGGA AGCTGGCACA
GTGCCCATTC GGTCATCACC ACTGAAGAAT ATTTCTGAGG GGTCACTGCC ACAACTAGAA TCAGAGTCAC ATTCTCCTAC
ATCACAGGCT GCAGATAGCT TACTAGATGC ATCTGACTCA AAGTCTGTGG CTGTGGCCTC AGAGGAGATG TCTCAGCTAC
CACTTGCATC GCAGGCAACT ACTACAGACC TTGTCAGTAC AACTGCAATG CAGCCACAAT CTGAGGGTAT AGTGGATGAG
TCATTGCAGC CTCAGCATCC ACCCTCTTCT ACCGCACATG ATTCACCTTG TTTACAGGAC TCTGTGCCAT TGGTGCCACC
ACCACCTTCC CCTTACCTAA ATAAAGGTTA GTATATTGCA TCTCACTTCC TCTAATTCCA TGTCTATATA ACTGCTATTG
TTTGTGTTGA CTTAGTATTT GTGATGAGTT TGGGGGTCTT TGGAAGGTGA AAATGAGTCA GTGTGAGATT GGATCAAACA
CCATGCAGAG GCTCTGAGAT GACCAAGTTT CTCAGGAAGG TCTATTTCAT TGATACCCTG ACTTGAGTAC ATAGGACGTC
CACGTACATG GCTCACTAAG CTAAAGAAAC ATCTTATCCT AAATATGATT CTCTTACCAC TAACAGGAAA CACATTTCTA
TCTTATCTAT TCTAACCTCT TAACTTGGCT TCCTTGATGT TCAAGGACAA CTGGACAACC TGGCCAGCCT TGCGTGCTCA
TGCTACTGGG TCGTGTTTGG AGTTCTACGA ACAGTTTTCT TTCCATTGAT TAATCATGTA CCAATCATAT GCCCATCTTA
GACTATATAA GTTTCCTATA ATTTGTGAAA AAAGTTGGCT TGTTTTTTGT GATTCTCAGT CTTTGATATG ATTTTGAAAG
AAGAATGCTC ATGCAAACTG TGGCTAGCAG ATATAAATTT AATGAACTAG TTGCGGGAAT CAGCATTAAG TCCTTAAAGT
TTACCAAGCA TGTAATGTGC TTTCATTCAT TCAAAAAAGC ATGTAATATG CTCACTTATA TCTCCATTGA TCCCCTATTT
GTGTATACCT GGTCCCTCTT AAGACAGTTT CAGCCAAAAT GATGAAGTTT GATTGCAATT GTGAAATATA GTACTAACTT
TTTTTTAGAG CAATAGATGA AAGGAATATA CTATGCTTCT GTGTACCTTC TCTTTGGATG TTATCCAATC CCTCAATATC
AATTCATACA TAGTTGTGAA CCAAAGAAGT CAGCTTTTCA CCCATAAATA AATCTGGGGC TAGTATATAA GTAATCCGGT
GTAATTCTCT CTCTCTCTCT CTGAGCATAA GTAACCTCTG TTGCTAACTT GTACAGAAGT AGGTCAAATG GTATGTGGAA
GCTGCCGTAT TCTTCTTGCT TATTTTAGAG GTGCTGGTTA TGTTCACTGT ACTTGTTGCC AGACAATGAA CTATGTATTG
GAAGGTGCGT ACTATTTCTC ATTTGCCCAA CAGTGTTTTA CTTTTGTTAT GCCCCATATA ATTTTTATTT TGTCTTTCAA
CACCTATAGA TATCAGCCAT CTTGTATCTT ACTTCTGTGG AAATACTTAC TGAATACTGA ACATGCTTTT TCTCAAAAAT
TTGCCTTCTG CTACTGTCTA AATTATGTGT AAGAAGTATG GTTGGTTACA TATTTCAACA TTGGACCACT CAATAGAGAA
CTGGAGAATT TTGCCCTTGC CTTTATAATA CTATTTGTTC ATGCACACCC TCTAAAGCTT TTTCATGCAA CACTTCTGCA
AAATATGGAT GCCATTTGCG CAAAATTTAT CTCGTCTTTG TCTTTCCTTT TGAAGCACGG CTGTCCTTAA TATTTCCATG
TATTATAGCT TTTACCAAAT ACTGATGTAC CGATGTGTGT ATATATGCAT CTTCTTACCC TTGCATGGGT TTTCCCCCTA
TGTTTGTTGC AGCTCATGAA GTTGGTAAGG TGCATTGTGG ACACTGTGCG ACATTATTGA TGTATCCTTT TGGTGCGCCT
GCTGTTAAGT GCTCGTTGTG CCTCTTTGTC ACTGAAATTG GAGTAAGTGA ACTATGGCTT GTGATAAATT TACTTGCTAT
ATGTGCTTAT TTGTGATAAA TATGTTGAAA AAGAAGGTAA TGCTACATTG AAAAAAAGAG AGAGAGAACT GATTATGTAC
TGTGCATGTT GGTCGAGTTG GTTTACTTTC TAATGAATAT GACTGCCTTA GATTCTAGAT TTCCCATGCA TCCGGTTGGC
TATATGAGCT AAATCACTAA TCCTGACAGG CATTATTTGC TATGTAAGCA TGTTGTACTG AGACCTATTG TTTATCAAAT
ATTAAGGTGA TACTACATAA ACTTCAATAT TTGCTCTAAA AGGCTAGAAA TCCCCATATT AATCAGATAG AGGGAGGGAG
GTTAACCAGA TAGATATATG GTAGATGGAA AGGAGGGATC TGAAGTCTGA AGCATGTTCT GAGCATGACT CAATATGCTC
CTTTAATAAA ATGTCGTGGC TCAGGTGCTT CATATATAAT AGACATGGTT TGCTTTATCT GAATCCCAGT CAACACATGA
AGCTTTTATC TTCCTCCTTG TCTCAGATAA TCATGCCGTG CACTATGATA GATCTGAAGC ACTACGAACT GTCTTTGACT
GTGACTCCAC TTTGATGCCT TCAGCTTTGG TTGCCTGCAA TCCTTTGCTG TTCCCACGCT TTCATTCAGT AGATTTCTTG
ATACTTAGAC TGTCGTTGCA GTGCATAATT GTTCAGCTAT TTGCCAATAC ATTGATCTCC TTCAATTCTT TGTTCCTTTT
GTTCCAGGAG CGGAATGTTC GCCGTCGGTT ATCAATCGAG CAACCCACAA GAACTAACTC ATCAGGGCTA GCTGAAGCCT
GATCAGTTCT GGTCCCATGT ACCCATCGGA TTCCAAGAAA GCTTCAAATG CTAATGTGGA TGAAAGGAAC AGAATGTTCG
CCCTTCGTCA TGAGGTGTGG GCATGAAAGT TCAAGATGGT ATGGACAAGC CAAAGTGTAC AAAGATAGCG TTTTTTTTTT
CATTGATGTA GACAGGAAAG GTGACCTTGT TAGTACGACT AGATCTCCTT TGAAAGGGAA AATAAAAGAA AAATAGTTCG
ATTCAATCTG GAGGTGATAT GCGTATGTCA TATGAATGAT AACAGAGTAG TTTTCAGATG GTTCTTTCGC GGTGACCATC
ATGTTGCCCC C