Os01t0612700-02

Locus

Os01g0612700

Description

LSD1-like-type zinc finger protein, Disease resistance, Saline-alkaline stress resistance

RAP-DB Gene Symbol Synonym(s)

LOL2, OsLOL2, OsLOL5

RAP-DB Gene Name Synonym(s)

LSD1-LIKE ZINC FINGER PROTEIN, LSD1-like 2, LSD1-like-5

CGSNL Gene Symbol

LOL2

CGSNL Gene Name

LSD1-LIKE ZINC FINGER PROTEIN

Oryzabase Gene Symbol Synonym(s)

OsLOL2, OsLSD5, OsLOL5, LOL5

Oryzabase Gene Name Synonym(s)

LSD1-like 2, lsd one like 2, LSD1-like-5

Transcript Evidence

AJ620677

Protein Evidence

Q704V3

Literature

PMID: 26920613

PMID: 17404758

Note

Manual Curation

June 20, 2017

Functional domain (InterPro)

Zinc finger, LSD1-type (IPR005735)

Others

Oryzabase (7293)

Transcript

741 bp

>Os01t0612700-02 LSD1-like-type zinc finger protein, Disease resistance, Saline-alkaline stress resistance
AGGAGATGTCTCAGCTACCACTTGCATCGCAGGCAACTACTACAGACCTTGTCAGTACAA
CTGCAATGCAGCCACAATCTGAGGGTATAGTGGATGAGTCATTGCAGCCTCAGCATCCAC
CCTCTTCTACCGCACATGATTCACCTTGTTTACAGGACTCTGTGCCATTGGTGCCACCAC
CACCTTCCCCTTACCTAAATAAAGAAGTAGGTCAAATGGTATGTGGAAGCTGCCGTATTC
TTCTTGCTTATTTTAGAGGTGCTGGTTATGTTCACTGTACTTGTTGCCAGACAATGAACT
ATGTATTGGAAGCTCATGAAGTTGGTAAGGTGCATTGTGGACACTGTGCGACATTATTGA
TGTATCCTTTTGGTGCGCCTGCTGTTAAGTGCTCGTTGTGCCTCTTTGTCACTGAAATTG
GAGAGCGGAATGTTCGCCGTCGGTTATCAATCGAGCAACCCACAAGAACTAACTCATCAG
GGCTAGCTGAAGCCTGATCAGTTCTGGTCCCATGTACCCATCGGATTCCAAGAAAGCTTC
AAATGCTAATGTGGATGAAAGGAACAGAATGTTCGCCCTTCGTCATGAGGTGTGGGCATG
AAAGTTCAAGATGGTATGGACAAGCCAAAGTGTACAAAGATAGCGTTTTTTTTTTCATTG
ATGTAGACAGGAAAGGTGACCTTGTTAGTACGACTAGATCTCCTTTGAAAGGGAAAATAA
AAGAAAAATAGTTCGATTCAA

CDS

492 bp

>Os01t0612700-02 LSD1-like-type zinc finger protein, Disease resistance, Saline-alkaline stress resistance
ATGTCTCAGCTACCACTTGCATCGCAGGCAACTACTACAGACCTTGTCAGTACAACTGCA
ATGCAGCCACAATCTGAGGGTATAGTGGATGAGTCATTGCAGCCTCAGCATCCACCCTCT
TCTACCGCACATGATTCACCTTGTTTACAGGACTCTGTGCCATTGGTGCCACCACCACCT
TCCCCTTACCTAAATAAAGAAGTAGGTCAAATGGTATGTGGAAGCTGCCGTATTCTTCTT
GCTTATTTTAGAGGTGCTGGTTATGTTCACTGTACTTGTTGCCAGACAATGAACTATGTA
TTGGAAGCTCATGAAGTTGGTAAGGTGCATTGTGGACACTGTGCGACATTATTGATGTAT
CCTTTTGGTGCGCCTGCTGTTAAGTGCTCGTTGTGCCTCTTTGTCACTGAAATTGGAGAG
CGGAATGTTCGCCGTCGGTTATCAATCGAGCAACCCACAAGAACTAACTCATCAGGGCTA
GCTGAAGCCTGA

Protein

164 aa

>Os01t0612700-02 LSD1-like-type zinc finger protein, Disease resistance, Saline-alkaline stress resistance
MSQLPLASQATTTDLVSTTAMQPQSEGIVDESLQPQHPPSSTAHDSPCLQDSVPLVPPPP
SPYLNKEVGQMVCGSCRILLAYFRGAGYVHCTCCQTMNYVLEAHEVGKVHCGHCATLLMY
PFGAPAVKCSLCLFVTEIGERNVRRRLSIEQPTRTNSSGLAEA*

5'UTR

chr01:24296432..24296436 (+ strand) : 5 bp

CDS

chr01:24296437..24296635 (+ strand) : 199 bp

chr01:24297626..24297733 (+ strand) : 108 bp

chr01:24298222..24298331 (+ strand) : 110 bp

chr01:24299097..24299171 (+ strand) : 75 bp

3'UTR

chr01:24299172..24299415 (+ strand) : 244 bp

FASTA

>Os01t0612700-02 class=Sequence position=chr01:24296432..24299415 (+ strand)
AGGAGATGTC TCAGCTACCA CTTGCATCGC AGGCAACTAC TACAGACCTT GTCAGTACAA CTGCAATGCA GCCACAATCT
GAGGGTATAG TGGATGAGTC ATTGCAGCCT CAGCATCCAC CCTCTTCTAC CGCACATGAT TCACCTTGTT TACAGGACTC
TGTGCCATTG GTGCCACCAC CACCTTCCCC TTACCTAAAT AAAGGTTAGT ATATTGCATC TCACTTCCTC TAATTCCATG
TCTATATAAC TGCTATTGTT TGTGTTGACT TAGTATTTGT GATGAGTTTG GGGGTCTTTG GAAGGTGAAA ATGAGTCAGT
GTGAGATTGG ATCAAACACC ATGCAGAGGC TCTGAGATGA CCAAGTTTCT CAGGAAGGTC TATTTCATTG ATACCCTGAC
TTGAGTACAT AGGACGTCCA CGTACATGGC TCACTAAGCT AAAGAAACAT CTTATCCTAA ATATGATTCT CTTACCACTA
ACAGGAAACA CATTTCTATC TTATCTATTC TAACCTCTTA ACTTGGCTTC CTTGATGTTC AAGGACAACT GGACAACCTG
GCCAGCCTTG CGTGCTCATG CTACTGGGTC GTGTTTGGAG TTCTACGAAC AGTTTTCTTT CCATTGATTA ATCATGTACC
AATCATATGC CCATCTTAGA CTATATAAGT TTCCTATAAT TTGTGAAAAA AGTTGGCTTG TTTTTTGTGA TTCTCAGTCT
TTGATATGAT TTTGAAAGAA GAATGCTCAT GCAAACTGTG GCTAGCAGAT ATAAATTTAA TGAACTAGTT GCGGGAATCA
GCATTAAGTC CTTAAAGTTT ACCAAGCATG TAATGTGCTT TCATTCATTC AAAAAAGCAT GTAATATGCT CACTTATATC
TCCATTGATC CCCTATTTGT GTATACCTGG TCCCTCTTAA GACAGTTTCA GCCAAAATGA TGAAGTTTGA TTGCAATTGT
GAAATATAGT ACTAACTTTT TTTTAGAGCA ATAGATGAAA GGAATATACT ATGCTTCTGT GTACCTTCTC TTTGGATGTT
ATCCAATCCC TCAATATCAA TTCATACATA GTTGTGAACC AAAGAAGTCA GCTTTTCACC CATAAATAAA TCTGGGGCTA
GTATATAAGT AATCCGGTGT AATTCTCTCT CTCTCTCTCT GAGCATAAGT AACCTCTGTT GCTAACTTGT ACAGAAGTAG
GTCAAATGGT ATGTGGAAGC TGCCGTATTC TTCTTGCTTA TTTTAGAGGT GCTGGTTATG TTCACTGTAC TTGTTGCCAG
ACAATGAACT ATGTATTGGA AGGTGCGTAC TATTTCTCAT TTGCCCAACA GTGTTTTACT TTTGTTATGC CCCATATAAT
TTTTATTTTG TCTTTCAACA CCTATAGATA TCAGCCATCT TGTATCTTAC TTCTGTGGAA ATACTTACTG AATACTGAAC
ATGCTTTTTC TCAAAAATTT GCCTTCTGCT ACTGTCTAAA TTATGTGTAA GAAGTATGGT TGGTTACATA TTTCAACATT
GGACCACTCA ATAGAGAACT GGAGAATTTT GCCCTTGCCT TTATAATACT ATTTGTTCAT GCACACCCTC TAAAGCTTTT
TCATGCAACA CTTCTGCAAA ATATGGATGC CATTTGCGCA AAATTTATCT CGTCTTTGTC TTTCCTTTTG AAGCACGGCT
GTCCTTAATA TTTCCATGTA TTATAGCTTT TACCAAATAC TGATGTACCG ATGTGTGTAT ATATGCATCT TCTTACCCTT
GCATGGGTTT TCCCCCTATG TTTGTTGCAG CTCATGAAGT TGGTAAGGTG CATTGTGGAC ACTGTGCGAC ATTATTGATG
TATCCTTTTG GTGCGCCTGC TGTTAAGTGC TCGTTGTGCC TCTTTGTCAC TGAAATTGGA GTAAGTGAAC TATGGCTTGT
GATAAATTTA CTTGCTATAT GTGCTTATTT GTGATAAATA TGTTGAAAAA GAAGGTAATG CTACATTGAA AAAAAGAGAG
AGAGAACTGA TTATGTACTG TGCATGTTGG TCGAGTTGGT TTACTTTCTA ATGAATATGA CTGCCTTAGA TTCTAGATTT
CCCATGCATC CGGTTGGCTA TATGAGCTAA ATCACTAATC CTGACAGGCA TTATTTGCTA TGTAAGCATG TTGTACTGAG
ACCTATTGTT TATCAAATAT TAAGGTGATA CTACATAAAC TTCAATATTT GCTCTAAAAG GCTAGAAATC CCCATATTAA
TCAGATAGAG GGAGGGAGGT TAACCAGATA GATATATGGT AGATGGAAAG GAGGGATCTG AAGTCTGAAG CATGTTCTGA
GCATGACTCA ATATGCTCCT TTAATAAAAT GTCGTGGCTC AGGTGCTTCA TATATAATAG ACATGGTTTG CTTTATCTGA
ATCCCAGTCA ACACATGAAG CTTTTATCTT CCTCCTTGTC TCAGATAATC ATGCCGTGCA CTATGATAGA TCTGAAGCAC
TACGAACTGT CTTTGACTGT GACTCCACTT TGATGCCTTC AGCTTTGGTT GCCTGCAATC CTTTGCTGTT CCCACGCTTT
CATTCAGTAG ATTTCTTGAT ACTTAGACTG TCGTTGCAGT GCATAATTGT TCAGCTATTT GCCAATACAT TGATCTCCTT
CAATTCTTTG TTCCTTTTGT TCCAGGAGCG GAATGTTCGC CGTCGGTTAT CAATCGAGCA ACCCACAAGA ACTAACTCAT
CAGGGCTAGC TGAAGCCTGA TCAGTTCTGG TCCCATGTAC CCATCGGATT CCAAGAAAGC TTCAAATGCT AATGTGGATG
AAAGGAACAG AATGTTCGCC CTTCGTCATG AGGTGTGGGC ATGAAAGTTC AAGATGGTAT GGACAAGCCA AAGTGTACAA
AGATAGCGTT TTTTTTTTCA TTGATGTAGA CAGGAAAGGT GACCTTGTTA GTACGACTAG ATCTCCTTTG AAAGGGAAAA
TAAAAGAAAA ATAGTTCGAT TCAA