Os01t0614700-02

Locus

Os01g0614700

Description

Adaptin ear-binding coat-associated protein 1 NECAP-1 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ABCI13

CGSNL Gene Name

ABC TRANSPORTER I FAMILY MEMBER 13

Oryzabase Gene Symbol Synonym(s)

OsABCI13

Oryzabase Gene Name Synonym(s)

ABC transporter superfamily ABCI subgroup member 13

Transcript Evidence

AK103190 (DDBJ, Best hit)

Protein Evidence

B4FRD1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: endocytosis (GO:0006897)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Adaptin ear-binding coat-associated protein 1 NECAP-1 (IPR012466)

Full-length cDNA

J033121N24 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0614700-02)

RiceXPro (AK103190)

Others

Oryzabase (12036)

KEGG (Os01t0614700-02)

Transcript

1438 bp

>Os01t0614700-02 Adaptin ear-binding coat-associated protein 1 NECAP-1 family protein.
GCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCAGTCTCTCTCCCCCCCAAGAAGAAATCC
ATTCCTCTCTCACGCGCCTCCGCGTCGCCGCATTCGGGGACGCCCACCGCCGCCGGATCC
GGCCAGCCTTCCCCCCTCCCCTCCTTTCCCCGGCCGCTCCCCTCCTCGGTAAGATCCGGC
GCCGGTTCCATGTCGAGCACCGGCGAGCAGTCGCAGGCGAAGGCGGAGGCCGAGGAGGCG
GTGGAGCTCGTGCTGTTCCAGGTCGCTGAGTGCTACGTCTACCTGATACCTCCCAGGAAG
ACAGCCGCCTCCTACAGGGCTGATGAATGGAACGTCAACAAGTGGGCTTGGGAAGGGACT
CTCAAGGTTGTCAGCAAAGGAGAAGAGTGCATCATCAAACTGGAAGATAAGAACACAGGG
GAGCTGTACGCTAGGGCATTCCTCAGAGAAGACGAACCACATCCGGTGGAACCTGTTATT
GATAGCAGCAGATATTTTGTACTCCGTGTTGAAGAGAATATAGATGGACGTCAGCGCCAT
GCCTTTATTGGTTTAGGCTTCCGTGAAAGACCTCAAGCATATGATTTCCAAGCTGCTCTG
CACGACCATATGAAATATCTAAACAAGAAAAAGACTGCTGAAGAGATGGTACAACACTAT
GAGAAATCATCATCAGTGGATTACAGCCTCAAAGAAGGGGAAACTTTGGTTTTGCAGCTA
AAAAATGTTGGTCTGGTGGGCTAAGAAACCGGCGGTTGAACCGGGATTTTCCCTTGTCAG
CTATTTTAACGGTCCCATTGGCCAGAACAGCCTGGCCCAGGTACCAGGTCCAGTTTTTTC
TGGCTGGGATTTTCTGATGTTTGGCCTTATTCTTTCTCCAATTCCCTAGAAAGAGTCCGG
CGCAAAGATAAAATCTGCATTTTTTGAGCAAGGCCTCAACAAGCTCTCATTTAACGAAAA
AGCCAACTCCAAGGAGGCCCCAGTTTCCCTCAAGCTCCCTCCACCTCCGCCATCACCGGT
CTCTCCTACAGATTCTGGCATCGCGGCTTCTCCGTTCAAAGCGGAGTTTCCTTCCCAAGA
CCAACCAGCTGCTGATACTGGAGCTGATACCACTCCTTTCAAAGCAGAATTTCCTTCTTC
TCATGAACAACCAGCCGCGGATAACGTCGCTTCTTCCCCACCACCGAAAGCAGAAGCTGC
TCCTCAGGAGCAACCAACTGCAGCAGAGAAGGCCCCTCAAGAGAGCGTGGACGACGACTT
CGGAGACTTTCAGGCAGCTGGGTGAATCATGTATCTTGTACATACCACATGTTACTCAAA
TTGCTCCTTTGATTTTCCATGTTCCATCAGTTGTGACTTCTGCCGGCACATGAGTTGCTG
TACAGTACAGAGAGCTAGTAACTATCTTGTTATAATCTATAAAAGAACAGATGGATAC

CDS

555 bp

>Os01t0614700-02 Adaptin ear-binding coat-associated protein 1 NECAP-1 family protein.
ATGTCGAGCACCGGCGAGCAGTCGCAGGCGAAGGCGGAGGCCGAGGAGGCGGTGGAGCTC
GTGCTGTTCCAGGTCGCTGAGTGCTACGTCTACCTGATACCTCCCAGGAAGACAGCCGCC
TCCTACAGGGCTGATGAATGGAACGTCAACAAGTGGGCTTGGGAAGGGACTCTCAAGGTT
GTCAGCAAAGGAGAAGAGTGCATCATCAAACTGGAAGATAAGAACACAGGGGAGCTGTAC
GCTAGGGCATTCCTCAGAGAAGACGAACCACATCCGGTGGAACCTGTTATTGATAGCAGC
AGATATTTTGTACTCCGTGTTGAAGAGAATATAGATGGACGTCAGCGCCATGCCTTTATT
GGTTTAGGCTTCCGTGAAAGACCTCAAGCATATGATTTCCAAGCTGCTCTGCACGACCAT
ATGAAATATCTAAACAAGAAAAAGACTGCTGAAGAGATGGTACAACACTATGAGAAATCA
TCATCAGTGGATTACAGCCTCAAAGAAGGGGAAACTTTGGTTTTGCAGCTAAAAAATGTT
GGTCTGGTGGGCTAA

Protein

185 aa

>Os01t0614700-02 Adaptin ear-binding coat-associated protein 1 NECAP-1 family protein.
MSSTGEQSQAKAEAEEAVELVLFQVAECYVYLIPPRKTAASYRADEWNVNKWAWEGTLKV
VSKGEECIIKLEDKNTGELYARAFLREDEPHPVEPVIDSSRYFVLRVEENIDGRQRHAFI
GLGFRERPQAYDFQAALHDHMKYLNKKKTAEEMVQHYEKSSSVDYSLKEGETLVLQLKNV
GLVG*

5'UTR

chr01:24375933..24376121 (+ strand) : 189 bp

CDS

chr01:24376122..24376217 (+ strand) : 96 bp

chr01:24376412..24376443 (+ strand) : 32 bp

chr01:24376760..24376860 (+ strand) : 101 bp

chr01:24376939..24377011 (+ strand) : 73 bp

chr01:24377156..24377187 (+ strand) : 32 bp

chr01:24377371..24377461 (+ strand) : 91 bp

chr01:24377905..24378016 (+ strand) : 112 bp

chr01:24378452..24378469 (+ strand) : 18 bp

3'UTR

chr01:24378470..24378614 (+ strand) : 145 bp

chr01:24379349..24379897 (+ strand) : 549 bp

FASTA

>Os01t0614700-02 class=Sequence position=chr01:24375933..24379897 (+ strand)
GCTCTCTCTC TCTCTCTCTC TCTCTCTCTC TCAGTCTCTC TCCCCCCCAA GAAGAAATCC ATTCCTCTCT CACGCGCCTC
CGCGTCGCCG CATTCGGGGA CGCCCACCGC CGCCGGATCC GGCCAGCCTT CCCCCCTCCC CTCCTTTCCC CGGCCGCTCC
CCTCCTCGGT AAGATCCGGC GCCGGTTCCA TGTCGAGCAC CGGCGAGCAG TCGCAGGCGA AGGCGGAGGC CGAGGAGGCG
GTGGAGCTCG TGCTGTTCCA GGTCGCTGAG TGCTACGTCT ACCTGGTACG CCCCGTGCGC CCCCCCCCCT CGCCGCCTTG
TTCTTCCTCC GGTTTGTTTG ACTGTTTAGG GTGTGTGTAG TCAGTGACCC GCTTCGTGCC CCCGTGCTTG TGTTCTCTTG
GGGGCGCGCA ATTCGTCGAG CACTATGTGT GCGTGAACGT GCTAATGTTT TTTTTTTAAT CCTCTCTCTC TTTACGCAGA
TACCTCCCAG GAAGACAGCC GCCTCCTACA GGTATATACT AGTCTTGGTT CATCAAAAAA ATCCCGATAG AAATGGGCTT
AGTAGGATTC ACATTTCAAT TTGTCCGCGG GAGCAAGGCT ATGTAGTTTG AAGGTTTGAC TGTGTGAGGG GCTAGACAGA
TCAAAGATAA CAATCTGAAT TAGCTATAGG TCGTCCTGTT TCGAGAACTC TCGTTCCATT GGCCCTATCG AATGCGGCAA
TCTTGGATTA GCTCACTCCA TTGTTGTACT TGTTCTGTTC TGATTTTGGT ATGACCTTAT GAGCCGAGAG CCTGAGTCAC
ATTTTTTAAA CCGTGGGTAT CAACCAGGGC TGATGAATGG AACGTCAACA AGTGGGCTTG GGAAGGGACT CTCAAGGTTG
TCAGCAAAGG AGAAGAGTGC ATCATCAAAC TGGAAGATAA GAACACAGGT ACAAAAAAAA TCACGGTAGT GCCGTTGGTC
AGTGCTTGTG TGATCACCAA TGTTGATTCC TCGGACACAT TTTTAGGGGA GCTGTACGCT AGGGCATTCC TCAGAGAAGA
CGAACCACAT CCGGTGGAAC CTGTTATTGA TAGCAGCAGG TCTGCATTTT TTCCCTGCCA CATGGTGGTT TAATCCTGTG
GTGACTTTTG TCCTTAGTGT TTCTATTCTG CATAAGTTAC TATGTAGAGA CTGTATAAAG ATAACCTGAA ATGATTGTTG
CTACTCCAAC ATTGTTTTTG CAGATATTTT GTACTCCGTG TTGAAGAGAA TATAGGTGAT AAGCTGATCT TCTCATGATT
TTTATGACTT TCTTGTGTCT TAATGTTTTT TCCATTGAGT TGGTGATCAT AGTGTTGAGG TGGTAAGCAT AGTGTTTGAA
GTGGCTTATC AGTTATCGCA TTGATCCATA CGTAGAAATA TATTAAGTTA TTAAAAAAAT CTTACCACAT ATTTTCAGAT
GGACGTCAGC GCCATGCCTT TATTGGTTTA GGCTTCCGTG AAAGACCTCA AGCATATGAT TTCCAAGCTG CTCTGCACGA
CCATATGAAG TATCCTTGTG TTCATTACTT GAAGCATGAT ATGTATTCGA ATGTTCTCCC ATGTAATCAC TCAATGGCTG
GGGACTCTGT ATGTGAATTT GATTCAATTG CAGTATCATT AAAATGGTCT AACATGACAT TGATTTCCTG TTAACACGCG
TACGTGTGAG ATTATTATTT TGAATGTTCA ACCATTTTAT TATTAAAAAG GTCTAAATGA ACCCAAAAAA ATCCTCTACC
CATACAATCA ATTCATAGGA TGTACTTTTT TGCTTGCCAA TTATGTTTCT TTTGGTCGGT CAGATGAAAT GTTTCTGTTT
TTGGTCACAA TGAATTCAAT TTGTATTTCC TTTTTGCAGT TGTAGTTGTG TATGGTAATA TTTTTATCCA ATAAGTTCTT
TTTATAACGG ACCATTTTCC GGTATGATTT GTTATTTCTT ACATCATCAA AGATATCTAA ACAAGAAAAA GACTGCTGAA
GAGATGGTAC AACACTATGA GAAATCATCA TCAGTGGATT ACAGCCTCAA AGAAGGGGAA ACTTTGGTTT TGCAGCTAAA
AAATGTAAGT TTTCATGTGT CATATTTTGG TGGTCAAACT AGAGATTGGT GATGTGAAAT TGTTTCTGTA GGCCTTCATG
ATGTAATTGT TGTTTTATTA GCTCAGTACT AGAGTATTAG CATCCTACCT AAAGCCACTA GAGCTGCTTG GTTGCTAAAG
TAATTACACA CAATGTTATT AGATCCAGAC CAGACATTGA CTTGTCCGAG GACTTGGATC AGTAAGTAAG AGGTTGAATC
GCTTGGTCAA CGGGTCTCAG ACCACATGAG CGTACTACTT CTTGTGCTAT TGTAGGCGTG TTAACAGCTA GTAGAAACAA
GCAAGTGGTG TTAGCCGAGT TGGTTTGCCC ATGCAAGCAA TTAGCAACAT CTTTTGAGTT TGAATTCCAG TTGTCACTAA
CTACTTTTGC AAATTTTGAA TGGCTCGTTA CCTGCCTAGG TTGGTCTGGT GGGCTAAGAA ACCGGCGGTT GAACCGGGAT
TTTCCCTTGT CAGCTATTTT AACGGTCCCA TTGGCCAGAA CAGCCTGGCC CAGGTACCAG GTCCAGTTTT TTCTGGCTGG
GATTTTCTGA TGTTTGGCCT TATTCTTTCT CCAATTCCCT AGGTATTTAA GAACGATAGT TGTCTGTTCT TATTATCTTG
ATTGTATTAC CATTTTAAAT TCTTAATCTG TGTATTCACT CATAAGATGC CTTATATATT GAGTAGGAAG TAGTTCAACA
TTTGGTTTCA CAAACATAAT TATTATGAAG TTAATTTTTG TGTCCACTCC AAGCATTGAC ACGCATAAAT TGTCAAACCG
TGAAATTTAT TAAGATGAAA ATATTATCTG TGCCAATTCT CAGAATTATC AGTTGTAAAA AAAATATATC ATGACAACCA
GGTTTACCAT GCATATGACA ATGCCTATTC ATGGCTCGAA GATATCAACC CTTATACGGC ATGTGTGATG AACGTGTCTT
AAGTACTTTT GTATTCAAAC AAACTTGTTT TAATAAGTTT CTTGTCTTGT TGAAATGAAG CTAACCGTAT AATGGTTTAC
AGGATCCTAC TATTTCTCAG TAATATTCAT ATTAGATTAT TTTGCTCTCT AGACTATTTT CCATGTAATG TGTTAAATAA
AACTGCATAT TTGTAGATAT ATCAGTTTGA GCTGCTCTTA CGTAGGGATC CATCTTAGCC TTATTGAACT TAATTGAAGG
ATATTTGCAC TGCCCCTACG CCAGATTTGG CACATCATTT GAGAAATAAC CTCTTGACGT CTCTTCTGAT TTTTGTAGTT
ATATGCTTCT TGTGCAACAT CTCCTTAATG TTTGGGTTTG CTTTTGTTCT GTGCAGAAAG AGTCCGGCGC AAAGATAAAA
TCTGCATTTT TTGAGCAAGG CCTCAACAAG CTCTCATTTA ACGAAAAAGC CAACTCCAAG GAGGCCCCAG TTTCCCTCAA
GCTCCCTCCA CCTCCGCCAT CACCGGTCTC TCCTACAGAT TCTGGCATCG CGGCTTCTCC GTTCAAAGCG GAGTTTCCTT
CCCAAGACCA ACCAGCTGCT GATACTGGAG CTGATACCAC TCCTTTCAAA GCAGAATTTC CTTCTTCTCA TGAACAACCA
GCCGCGGATA ACGTCGCTTC TTCCCCACCA CCGAAAGCAG AAGCTGCTCC TCAGGAGCAA CCAACTGCAG CAGAGAAGGC
CCCTCAAGAG AGCGTGGACG ACGACTTCGG AGACTTTCAG GCAGCTGGGT GAATCATGTA TCTTGTACAT ACCACATGTT
ACTCAAATTG CTCCTTTGAT TTTCCATGTT CCATCAGTTG TGACTTCTGC CGGCACATGA GTTGCTGTAC AGTACAGAGA
GCTAGTAACT ATCTTGTTAT AATCTATAAA AGAACAGATG GATAC