Os01t0615100-01

Locus

Os01g0615100

Description

Chymotrypsin protease inhibitor, Salt and osmotic stress tolerance

RAP-DB Gene Symbol Synonym(s)

OCPI2

RAP-DB Gene Name Synonym(s)

O. sativa chymotrypsin protease inhibitor 2, subtilisin-chymotrypsin protease inhibitor 2

CGSNL Gene Symbol

OCPI2

CGSNL Gene Name

O. SATIVA CHYMOTRYPSIN PROTEASE INHIBITOR 2

Oryzabase Gene Symbol Synonym(s)

OsSRO1a, SRO1a

Oryzabase Gene Name Synonym(s)

O. sativa chymotrypsin protease inhibitor 2, chymotrypsin protease inhibitor 2, subtilisin-chymotrypsin protease inhibitor 2, similar to RCD one 1a

Transcript Evidence

AK062495

Protein Evidence

Q5ZDX2

Literature

PMID: 29260397

PMID: 25910649

Note

Manual Curation

September 21, 2018

Gene Ontology (GO)

Biological Process: response to wounding (GO:0009611)

Molecular Function: serine-type endopeptidase inhibitor activity (GO:0004867)

Functional domain (InterPro)

Proteinase inhibitor I13, potato inhibitor I superfamily (IPR036354)

Proteinase inhibitor I13, potato inhibitor I (IPR000864)

Experimentally confirmed subcellular location

cytosol (GO:0005829)

Full-length cDNA

001-103-H12 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0615100-01)

RiceXPro (AK062495)

Others

Oryzabase (22313)

KEGG (Os01t0615100-01)

Transcript

486 bp

>Os01t0615100-01 Chymotrypsin protease inhibitor, Salt and osmotic stress tolerance
CAAACGCACACACAACTTAAGAATCGATCAATAGAGCATCTATCATTCTGCTGGACAATA
ACACCCGTTTCAGTCTCGATAGCAAGCAGTTTCAATTGGTTGAATTTTGCTTCATTAATT
TGCTGTGACCAGAATGAGTTCATCAGACAGCAAGCCATGTGGTGGTCTTAAGACGGAGTG
GCCGGAGCTAGTTGGCCTCACCATCGAGCAGGCCAAGGCGAAAATCAAGGCTGACCGTCC
AGACCTCCAAGTTGAGGTGCTCCCAGTAGGAACCATCATCCTGGGAGTGGTCGTCCCGAA
CCGTGTCATCCTCTGGGTCGACACTGTGGCCGAGATTCCCAAGATTGGCTAATTAGTTTT
AAGCTGTGTCTAGCTATAAGTGTAATGATACAATAATGAAAGGTCCTTGCTTTTTATATA
TATCTGATGCATGTTGTAATGTGATAAATAAAGAAGGTATAAATAAAGAAGATAGTATGT
GCATGT

CDS

219 bp

>Os01t0615100-01 Chymotrypsin protease inhibitor, Salt and osmotic stress tolerance
ATGAGTTCATCAGACAGCAAGCCATGTGGTGGTCTTAAGACGGAGTGGCCGGAGCTAGTT
GGCCTCACCATCGAGCAGGCCAAGGCGAAAATCAAGGCTGACCGTCCAGACCTCCAAGTT
GAGGTGCTCCCAGTAGGAACCATCATCCTGGGAGTGGTCGTCCCGAACCGTGTCATCCTC
TGGGTCGACACTGTGGCCGAGATTCCCAAGATTGGCTAA

Protein

73 aa

>Os01t0615100-01 Chymotrypsin protease inhibitor, Salt and osmotic stress tolerance
MSSSDSKPCGGLKTEWPELVGLTIEQAKAKIKADRPDLQVEVLPVGTIILGVVVPNRVIL
WVDTVAEIPKIG*

5'UTR

chr01:24392841..24392941 (+ strand) : 101 bp

chr01:24393039..24393070 (+ strand) : 32 bp

CDS

chr01:24393071..24393289 (+ strand) : 219 bp

3'UTR

chr01:24393290..24393423 (+ strand) : 134 bp

FASTA

>Os01t0615100-01 class=Sequence position=chr01:24392841..24393423 (+ strand)
CAAACGCACA CACAACTTAA GAATCGATCA ATAGAGCATC TATCATTCTG CTGGACAATA ACACCCGTTT CAGTCTCGAT
AGCAAGCAGT TTCAATTGGT TGTAAGTACC TGTTCTGATC TTAATTTGAT GAAAGAGTGT TTCGAATTAA GTGCCTTGCG
TGTACACAAC AACAAATTAA TCCTAGCTAT ATTTGCAGGA ATTTTGCTTC ATTAATTTGC TGTGACCAGA ATGAGTTCAT
CAGACAGCAA GCCATGTGGT GGTCTTAAGA CGGAGTGGCC GGAGCTAGTT GGCCTCACCA TCGAGCAGGC CAAGGCGAAA
ATCAAGGCTG ACCGTCCAGA CCTCCAAGTT GAGGTGCTCC CAGTAGGAAC CATCATCCTG GGAGTGGTCG TCCCGAACCG
TGTCATCCTC TGGGTCGACA CTGTGGCCGA GATTCCCAAG ATTGGCTAAT TAGTTTTAAG CTGTGTCTAG CTATAAGTGT
AATGATACAA TAATGAAAGG TCCTTGCTTT TTATATATAT CTGATGCATG TTGTAATGTG ATAAATAAAG AAGGTATAAA
TAAAGAAGAT AGTATGTGCA TGT

Locus: Os01g0615100

Loading...

Locus: Os01g0615100

Loading...