Os01t0620100-01

Locus

Os01g0620100

Description

WD40 domain containing protein, Cold tolerance

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsWD40-19, WD40-19

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK070122

Protein Evidence

Q5ZBF5

Literature

PMID: 30013584

Note

Manual Curation

November 1, 2018

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

WD40/YVTN repeat-like-containing domain superfamily (IPR015943)

WD40-repeat-containing domain superfamily (IPR036322)

WD40-repeat-containing domain (IPR017986)

WD40 repeat (IPR001680)

Full-length cDNA

J023044A10 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0620100-01)

RiceXPro (AK070122)

Others

Oryzabase (10700)

KEGG (Os01t0620100-01)

Transcript

1259 bp

>Os01t0620100-01 WD40 domain containing protein, Cold tolerance
AGTGTCCGTACACCCAACCCACCTGGGCCGCCGCGTCTCGTTCTCTCCTCCAACAAACCC
ACCTCCGAGCAGGCTGCGTGCTCTCGCCGCCGCCGCCACCGTAGGCGAGGGCATCTCATC
TCAGGGAGGAATGGCGGAGCGGCAGGTGGCGGAGCTGGGGGCCGGCGCGGCGTGCGTAGG
CTGGAACCACTGCGGCCGCCGCCTCGCCGCCGGCGCCGTCGACGGCTTCGTCTCCGTCTA
CGACTCCCAGTCCCAGCCGTCGCCTTCCTCCAAGTGGCAGGCCCACAAGCATGCGATCCT
GAATATCGTGTGGCTTCCTCCGGACTATGGGGATGCTATAGCTTGTGTTTGTGCTGATGG
GACGCTATCTTTGTGGGAGGAGGTCAGTGAAGATGATCAACTTCCAACCTGGAGGAAATG
TAAAGTATTTGAGAGTGGCAATTCTCACATACTACACGTACAGTTTGGATTACAACTGTC
TAGTCTAAAAATGGTTACTGCATACTCAGATGGCCAAGTGAAGGTTTATGAGCTCTTGGA
CTCGTTGGAATTAGACAAGTGGCAGCTTCAGGCGGAGTTCCAGAACATTACAGATCCTGT
TTCCCGATCTGGGAAGCCAGCATGTACTTCTGCATCAATTGCATGGAGTCCAAGAAGAGG
TGAAAGTCAGCAGGCTAGTTTTGCTATTGGTTTCAATTCAGACTCTCCAAATTTCAACTC
TTGTAAGATTTGGGAGTTCGAAGAAGCTCACCAGCGTTGGCTCCCCCTTGTTGAGCTTGG
CTCACCTCAGGATAAGGGGGATATAGTGCATGCTGTAGCATGGGCTCCTAACATCGGCAG
ACCATATGAGATCATAGCAGTTGCGACATGTAAAGGAATCGCAATCTGGCATATAGGCTT
AAGCGCTGAATCTGACGGCAGCCTGTCAACTGAGAATGTGGCTGTACTTTCTGGCCATGA
TGGGGAGGTCCTGCAACTGGAATGGGACATGGGCGGTATGACACTCGCATCGACCGGAGG
TGATGGCATGGTTAAGCTATGGCAGGCTAACCTGAATGGAGTTTGGCATGAACAAGCTGT
GCTTGACTGCAATGTGTCTCACTAGGGTTGCATATCTTTTTTTTCTGGTTGGAACTGGGG
CCTTGGGGGATTCCCAGCTCCCAAGTTGTGCAAACAAGCATTTAAGTGGATTGCTTATCA
ATGTTAAAGAATTCTGCAAGATCTCTTTCAATTATACTGTCGTGCACGTGGTTGGTTTT

CDS

975 bp

>Os01t0620100-01 WD40 domain containing protein, Cold tolerance
ATGGCGGAGCGGCAGGTGGCGGAGCTGGGGGCCGGCGCGGCGTGCGTAGGCTGGAACCAC
TGCGGCCGCCGCCTCGCCGCCGGCGCCGTCGACGGCTTCGTCTCCGTCTACGACTCCCAG
TCCCAGCCGTCGCCTTCCTCCAAGTGGCAGGCCCACAAGCATGCGATCCTGAATATCGTG
TGGCTTCCTCCGGACTATGGGGATGCTATAGCTTGTGTTTGTGCTGATGGGACGCTATCT
TTGTGGGAGGAGGTCAGTGAAGATGATCAACTTCCAACCTGGAGGAAATGTAAAGTATTT
GAGAGTGGCAATTCTCACATACTACACGTACAGTTTGGATTACAACTGTCTAGTCTAAAA
ATGGTTACTGCATACTCAGATGGCCAAGTGAAGGTTTATGAGCTCTTGGACTCGTTGGAA
TTAGACAAGTGGCAGCTTCAGGCGGAGTTCCAGAACATTACAGATCCTGTTTCCCGATCT
GGGAAGCCAGCATGTACTTCTGCATCAATTGCATGGAGTCCAAGAAGAGGTGAAAGTCAG
CAGGCTAGTTTTGCTATTGGTTTCAATTCAGACTCTCCAAATTTCAACTCTTGTAAGATT
TGGGAGTTCGAAGAAGCTCACCAGCGTTGGCTCCCCCTTGTTGAGCTTGGCTCACCTCAG
GATAAGGGGGATATAGTGCATGCTGTAGCATGGGCTCCTAACATCGGCAGACCATATGAG
ATCATAGCAGTTGCGACATGTAAAGGAATCGCAATCTGGCATATAGGCTTAAGCGCTGAA
TCTGACGGCAGCCTGTCAACTGAGAATGTGGCTGTACTTTCTGGCCATGATGGGGAGGTC
CTGCAACTGGAATGGGACATGGGCGGTATGACACTCGCATCGACCGGAGGTGATGGCATG
GTTAAGCTATGGCAGGCTAACCTGAATGGAGTTTGGCATGAACAAGCTGTGCTTGACTGC
AATGTGTCTCACTAG

Protein

325 aa

>Os01t0620100-01 WD40 domain containing protein, Cold tolerance
MAERQVAELGAGAACVGWNHCGRRLAAGAVDGFVSVYDSQSQPSPSSKWQAHKHAILNIV
WLPPDYGDAIACVCADGTLSLWEEVSEDDQLPTWRKCKVFESGNSHILHVQFGLQLSSLK
MVTAYSDGQVKVYELLDSLELDKWQLQAEFQNITDPVSRSGKPACTSASIAWSPRRGESQ
QASFAIGFNSDSPNFNSCKIWEFEEAHQRWLPLVELGSPQDKGDIVHAVAWAPNIGRPYE
IIAVATCKGIAIWHIGLSAESDGSLSTENVAVLSGHDGEVLQLEWDMGGMTLASTGGDGM
VKLWQANLNGVWHEQAVLDCNVSH*

5'UTR

chr01:24708782..24708911 (- strand) : 130 bp

CDS

chr01:24708632..24708781 (- strand) : 150 bp

chr01:24707981..24708092 (- strand) : 112 bp

chr01:24706858..24706958 (- strand) : 101 bp

chr01:24706328..24706405 (- strand) : 78 bp

chr01:24706005..24706160 (- strand) : 156 bp

chr01:24705134..24705246 (- strand) : 113 bp

chr01:24704243..24704369 (- strand) : 127 bp

chr01:24703925..24704062 (- strand) : 138 bp

3'UTR

chr01:24703771..24703924 (- strand) : 154 bp

FASTA

>Os01t0620100-01 class=Sequence position=chr01:24703771..24708911 (- strand)
AGTGTCCGTA CACCCAACCC ACCTGGGCCG CCGCGTCTCG TTCTCTCCTC CAACAAACCC ACCTCCGAGC AGGCTGCGTG
CTCTCGCCGC CGCCGCCACC GTAGGCGAGG GCATCTCATC TCAGGGAGGA ATGGCGGAGC GGCAGGTGGC GGAGCTGGGG
GCCGGCGCGG CGTGCGTAGG CTGGAACCAC TGCGGCCGCC GCCTCGCCGC CGGCGCCGTC GACGGCTTCG TCTCCGTCTA
CGACTCCCAG TCCCAGCCGT CGCCTTCCTC CAAGTGGCAG GTCAGGTTTA CCACCGAAAC CAGAATCCTC CCCCCGCCTT
AAACCCTGAG TATCTTCAAC CCCACCAGGA ACCTGCCCCT TTCTCGCTCT TGAGCTTCGA AGCGTAGTTG GTATTGGTGC
AAAGCTTAGG GCTTTTTGTT AGTGTATCAG GATTCTGCTT GTACGCATAC CTGCATAGGA AAATTCGTCA TGGATGTGTA
TTTAGTACTA GTAAATAATG CAGGGCTCTT GTTCTTTAGT GCAGAAAATT AGTCTACTTT CAACCAAACA CAAGATATAC
CAGGACATTT TAGTGTGTTT GTATTATTAG TGTGCCAAAC TAGAACAGTA AATACATGTG TATTGCTAGA GTCGTGAGGT
TGAATTGGTG ATTGTTCTGG AAATTATCAG GAGATGTTGT ACTGAAGGAA ATGGAACGGT AAATGATTGT TGCTGTGTTA
TCCATTGCAT GTTTCTGTTT GATATCTCTT GTGTTTGCTC TGTGGTTTCT GTTACCACAT CCATTTGTTT GACCTGGGTT
CGTTATGGTG TTGAGTCAGG CCCACAAGCA TGCGATCCTG AATATCGTGT GGCTTCCTCC GGACTATGGG GATGCTATAG
CTTGTGTTTG TGCTGATGGG ACGCTATCTT TGTGGGAGGA GGTCAGTGAA GGTTAGTTGT TCTTATGCCT TTTAAGTTGT
GTTTTGGTCT ACTTTGCGGT GGAGAGAGAG TTTCCTTTTC TTAGTTCTTT ATATTGAAAA ATCTGAACAA TAACTTATCC
AAGTGATGTT AAAGGCCACA TGGGAAGTTG GGAACCATTG ATTTTTATGT ACTTACTGTT ACAGTCTATA TAGCTAACTC
AACTTGCCTT TGGCCATCAA AATGTATGTG GCTGATACAG AGTAGAATAT TGTTATTGTT CCTGCTACTT CCATGGTTTT
AATTTTGTTT GTACTTGGGT ATTGGATTTC AAGCACTTTT CTTATGATAT TTTGATTTAT CATGTACATC GTGACCTCTT
TTTTCTAGAA TATTGCAGAT TCTCTTTTGT TTTGTTTTGA AATATTAGGT TCTCCCAACC TATGGAAATG GCCATTAAAA
GTTTTGAAAT ATTTTGTAAC ATAGCATTCA TTATCATCTA CCTTTCCACA AAATTTTAAC TTGAAGACAC TTCTTGTATG
AGGAGAAACA AAGAAAATGT CACTAGTGAG TGAAATGATG TGGTTTTAGT AGTTCAGAGG GATGAAGCAA GACTTAGAAC
AAAAAAAAGG TTTAGGTGTT TAAGTACTCC AACGGGGAAA CTTTCAGGGG AGTCAGAATG GACAGTTTCT TTTAATGATA
TGTTATTTGT AGTGCAACCA ACAATATATC TAAACCAGTA TAGCGACATC AAGTTCTCCT AAAGCTCTAG TGAGTTTACC
TGAAATTCAC TTAATGCACA TGTTCTTATG AAAATTCAAA TGAGAAATAT TAAATGGTTT GTGTAAAATA CTTATTTGAT
TAACAAAGTA ATAAAATAAA TGTTGCTAAA TTCTCTTAAT GGTACATATT TCAGTTAAAC ATATACTATA TTTATCACAA
CTCTTTTGTT ATTTTCTTTC AGAAAAGAAA ACGTTTTATT TCATGCTGTA CTGCATTCCT TGTTATTTTC TTTATATGGA
AATGGCAGTC AAACTCAAAT TTTCCTTTGA CAGATGATCA ACTTCCAACC TGGAGGAAAT GTAAAGTATT TGAGAGTGGC
AATTCTCACA TACTACACGT ACAGTTTGGA TTACAACTGT CTAGTCTAAA AATGGTAAGC TCTAACATCT GAATTTGTGT
TTGCAACTCC AATTCACACC TTTTTCATGC CAATAGAACC ATTTTTTATT TTTCTTTATT TGGGAGAAAT GGCATTCATT
ATAAATCACG AAATTTCTGT AGATGGTTCA GACTTGCTGA AAGTACTCTC TGCACCTTGT ACATCAGATT AAATTACAGT
AGATGAAGGC AATGCCACAA TGGAGCTATG TTAATGAGCA TATGAAAGTT TGTTAAGCAG CACAAAAGTC TAGAAATGTT
AACTAGAAAC AACCAATAGT GACTAGCCAG CAACAACTCA TATTTATGCA ATTAAATGTT ATTTTGCTTT GACTGTTCTG
CAGGTTGTCT GTGTATCGAA ACTTTTGTAT TGGTGTCCAC ATATGATATG TTGTGTGTGT ACCTCATTCG TTGGTAGTAA
GTAGTAACTT CTGTTGGTCT CCACAGGTTA CTGCATACTC AGATGGCCAA GTGAAGGTTT ATGAGCTCTT GGACTCGTTG
GAATTAGACA AGTGGCAGCT TCAGGTTTAT CTAACTTCTG TTCACATTTA CCAATGTTCT CAATCATTTA GTTTGGTTCC
TATATATTCC TTGCTAATCT AAACTAGCAA ACCCATTTCT TCCATTGAAT AGTGCTATAG TCATCTGATC TGTTTAACAA
TAGCAATTAC TAAGTAATAA CAACATTTCA GGCGGAGTTC CAGAACATTA CAGATCCTGT TTCCCGATCT GGGAAGCCAG
CATGTACTTC TGCATCAATT GCATGGAGTC CAAGAAGAGG TGAAAGTCAG CAGGCTAGTT TTGCTATTGG TTTCAATTCA
GACTCTCCAA ATTTCAACTC TTGTAAGGTA CGTGGAATTT AGTGTAGTAC TATTTTTATT TCATTATTGT CTGCATAAAT
TACAGTGACT CCATTCCAGC AGGTAGCAGC AGGACAGAAC TTATTATTTC CTATCAACAT CGTTCTTCTG TAGTACATCT
GTTTATGCAT ACTAAATAAA GCATAAAGTA ATTGTTCTTT TGCATAGAGA TCTTCCATGC ATTAAATTTT CTTTCATATG
CTCAAATTTA CCTTCTATAT TTACTACTTA CTAGCCTAGA GCCCGTGCAT TGCAGCGGAA AACAAATTGA GTTTCTAGCT
TATTAAATCA ATTAATAAGC ACTTATTTAG TCTAAGTAAT ACTATGATTT TTCTTATTGA ACAAGTAATA GGTGATTTTG
AAATTTGGGG GGAGCTAATA GTGAAATGGA GGACTTGTTA AAAGGTGGTG TAATAGTATA GATTGTGGGA CCCAGATGTT
AGTGGTAGGT GTGGTGTGGG AATGGACACC ACCACTACTA ACATTTTAAG TAAAATAGAG AATAGATAAC CAAGAAGTAG
AAAAGCAAAC CACTATTTTA TCTCTTCTGC ATTTGGAGGA AATAAATAGT AGTAGTAATT CGGGAGATCA TTGTAGGTTT
AAATCTGTAA AAAGTATTAC TGAAACCTTG CATGAAGTAG ATTTGGTTTT GTATTTAGTG AGTAATCAGT TTTTCTTTTG
CCTAGTTCAT GAGCTGTCGT CTGTTTCTGA CACTATTCTA ATAAAATAAT GAAAATGGTG AACAGATTTG GGAGTTCGAA
GAAGCTCACC AGCGTTGGCT CCCCCTTGTT GAGCTTGGCT CACCTCAGGA TAAGGGGGAT ATAGTGCATG CTGTAGCATG
GGCTCCTAAC ATCGGCAGGT TGTTCCTTTC TTCAGCAAGC ATAACAGTTG ACATGCCTTA ATTTTTCAAT ATGTATTGTG
TTTTGAATGT TTTGTGTTCA CTGCTGATAT TAGCATCATT TAGTTGCTTA ACTTCTATAA CAAATAACTG GTTTCTTAAG
ATGAAATTGT CATTGGATGA GGGTGATTGA CTTATGCTTG AGCCACTTAT GGTGTTCATT GTTGTTTCTG TCGTGTAAAA
ATGTTGCAGC TCGTAGCAAC TATGGAATCA GGCAAGTAAA TTTTGACATG TTCAAATACA CACTATGTAG AAGATTATTA
GTCGAATACA TTTCCTGTTC TTTTGCCATA ATTTAGATAT ATTATGTTGT CTGACACTTG CTGCGTTTGG TTTAGTATTC
AACATTGTGT CCTCTGCCTC TATAATAATG TAGCAATCTG GGAGACAAGT AAAATGATAT ATTTTGGAAT TTTGAGCTGT
TGAGAATGAA AATGAAAATG GTGAACAGAT TTGGGGGTTC GAATAAGCTA TAGTTAGTAT GTACATGATG GCACGTGGAA
CATATAAACA TAGTCAGCAT GCAAAACTAA AGGCTAATTG ATGGTTGGGT GACCTTGGGC TGGGCTTCGA AAAAGTATGG
CAATTGGTCC ATCATGACCA TGCTTATAAG AGCCCTGGTA GAGCATCATA TTCAGATAGT GTTTCAATCT CCCATGGGCA
TAGGGGTTTG TTTTTACCAT CCTAATATGC TCTGCTAATT ATTTTCACAT AATGTGTTTC AGACCATATG AGATCATAGC
AGTTGCGACA TGTAAAGGAA TCGCAATCTG GCATATAGGC TTAAGCGCTG AATCTGACGG CAGCCTGTCA ACTGAGAATG
TGGCTGTACT TTCTGGCCAT GATGGGGAGG TACAATAAAC TTGTCTTGTC TTTGTGCAGT AGTTATTGGC TGTATTACAT
GGGCTTTCTG GAGAATGTCT TTTGTTCATG AGGCTCCTTG AGAAATTACA GTATAGTTGA AGAGGACTGG TCCTAGTGTA
ATTTTTACTG ATTATTCGGT ACACATGCTT GTTTTTCACA CCTTACTAGG TCCTGCAACT GGAATGGGAC ATGGGCGGTA
TGACACTCGC ATCGACCGGA GGTGATGGCA TGGTTAAGCT ATGGCAGGCT AACCTGAATG GAGTTTGGCA TGAACAAGCT
GTGCTTGACT GCAATGTGTC TCACTAGGGT TGCATATCTT TTTTTTCTGG TTGGAACTGG GGCCTTGGGG GATTCCCAGC
TCCCAAGTTG TGCAAACAAG CATTTAAGTG GATTGCTTAT CAATGTTAAA GAATTCTGCA AGATCTCTTT CAATTATACT
GTCGTGCACG TGGTTGGTTT T

Locus: Os01g0620100

Loading...

Locus: Os01g0620100

Loading...