Os01t0626400-01

Locus

Os01g0626400

Description

WRKY transcription factor, Control of flowering time and plant height

RAP-DB Gene Symbol Synonym(s)

WRKY11, OsWRKY11, Dlf1, OsWRKY11.1

RAP-DB Gene Name Synonym(s)

WRKY GENE11, Rice WRKY gene11, semidwarf and late flowering 1

CGSNL Gene Symbol

WRKY11

CGSNL Gene Name

WRKY GENE11

Oryzabase Gene Symbol Synonym(s)

OsWRKY11, Dlf1, OsWRKY11.1, OsWRKY11.2

Oryzabase Gene Name Synonym(s)

Rice WRKY gene11, semidwarf and late flowering 1

Transcript Evidence

AK108745

Protein Evidence

Q9FE35

Literature

PMID: 25036785

Rice WRKY Working Group 2012. Rice 5:3.

Note

Manual Curation

December 1, 2016

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: transcription factor activity, sequence-specific DNA binding (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

WRKY domain (IPR003657)

Full-length cDNA

002-150-E09 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0626400-01)

RiceXPro (AK108745)

Others

Oryzabase (6522)

KEGG (Os01t0626400-01)

Transcript

1492 bp

>Os01t0626400-01 WRKY transcription factor, Control of flowering time and plant height
ACATAAGCTAGCTCCCCATACTCTCACACCCCATGTCTTCTGGAGGAGGAGGAGGAGGAG
GAGGAGATCGCCATGGCCCCTACCACCAGCACGGGCACCTCGGCCGCGGCGAAGGCGCTG
ATTACGTGTACAGCAGCAGCGACATGGAGAGCTTCTTCTTCAGCCAACCCGGGGGCGTCG
GCATCGGCGGGGGTGGTGGTGGCGTCGTCGGCGCCGGCGGTGCCGACGAGATCATGCCGT
ACTCCAGCATCACGGACTACCTGCAGGGGTTATTGGACCCCTCCGGGCTAGCTCGGCACC
TCGACGTGGCGTGCCCGTCGTCTCAGGACACGGTGGTCAAGCAGGAGCTGTCGGTGGATG
TGACGAGccacgacagccagggcaccggcggcgtcgccggagaaggcgtcgcgcaggcca
cgccgaactcgtcggcgtccttctcgtccAGCGACGGAGAGGCGGAGGGCGGCAAATCGT
CACGCCGGTGCAAGAAGGGTCAGGCGAAGGCGGAGGAGGAGGACGACAAGGATGAGGAGG
ATGGAGAGAACTCCAAGAAACCGAACAAGCCCAAGAAGAAAGCTGAGAAGAGGCAGCGGC
AGCCTCGCGTGGCGTTCCTCACCAAGAGCGAGGTTGATCACCTCGAGGACGGCTACCGGT
GGCGCAAGTACGGCCAGAAGGCAGTCAAGAACAGCCCATACCCGAGGAGCTACTACCGGT
GCACGACGCCCAAGTGCGGTGTGAAGAAGCGGGTGGAGCGGTCGTACCAGGACCCCTCCA
CGGTGATCACCACGTACGAAGGGCAGCACACGCACCACAGCCCGGCGAGCCTCCGCGGCG
GCGGCGGCGGCGTCGGCATCGTCGGAGGGCACCACCACCACCACCTCTTCATGCCCGGCG
TGCATGGCCTGCCGCCGTCGCACCTCATGCCGGCGGGGTTCCACCCTGAGCTGATGGGCC
TCATGCACCACCACCCGGCCATGGCCGCCGCCGCCGCAAACCCTAGCATGTACTTCCCGG
GCGTAGCTGCTTCTGCTCCGCCGCCTCCTGCTGTGGCTGGCGGCGGTGCAATGCCGCCCA
ACGATCATCCTCCTCTTCAGCAGCATCACTTCACTGACTACGCCCTGCTGCAAGACCTTT
TCCCTTCCACAATGCCCAGCAGCAACCCATGATGATGACTGATCTAACTGATTCTGCACA
AATATATACTACTCAATATTTAACTAGCACCCGGAATTTATCAAGATGCTTTTCAAACAT
TGGAGTCGTTGCGCCAAAAATGTGATGGCTAGGGAGTGCTTGATGATCAGCTTGGTCTTG
AGATGGAAGCTACAACTTTATAACTAGAACGGCTGCATTCCACTTGATTCTTCAGCATAG
CCCTTTACTGTTCTGCACCTCTAGACTTATTGTACATGCATGTACTAGTGTATATCATGT
GTACCTCATTGACTCATTTTCGGAGAGAGCAAATTAATTAATATTTCGTCTC

CDS

1140 bp

>Os01t0626400-01 WRKY transcription factor, Control of flowering time and plant height
ATGTCTTCTGGAGGAGGAGGAGGAGGAGGAGGAGATCGCCATGGCCCCTACCACCAGCAC
GGGCACCTCGGCCGCGGCGAAGGCGCTGATTACGTGTACAGCAGCAGCGACATGGAGAGC
TTCTTCTTCAGCCAACCCGGGGGCGTCGGCATCGGCGGGGGTGGTGGTGGCGTCGTCGGC
GCCGGCGGTGCCGACGAGATCATGCCGTACTCCAGCATCACGGACTACCTGCAGGGGTTA
TTGGACCCCTCCGGGCTAGCTCGGCACCTCGACGTGGCGTGCCCGTCGTCTCAGGACACG
GTGGTCAAGCAGGAGCTGTCGGTGGATGTGACGAGccacgacagccagggcaccggcggc
gtcgccggagaaggcgtcgcgcaggccacgccgaactcgtcggcgtccttctcgtccAGC
GACGGAGAGGCGGAGGGCGGCAAATCGTCACGCCGGTGCAAGAAGGGTCAGGCGAAGGCG
GAGGAGGAGGACGACAAGGATGAGGAGGATGGAGAGAACTCCAAGAAACCGAACAAGCCC
AAGAAGAAAGCTGAGAAGAGGCAGCGGCAGCCTCGCGTGGCGTTCCTCACCAAGAGCGAG
GTTGATCACCTCGAGGACGGCTACCGGTGGCGCAAGTACGGCCAGAAGGCAGTCAAGAAC
AGCCCATACCCGAGGAGCTACTACCGGTGCACGACGCCCAAGTGCGGTGTGAAGAAGCGG
GTGGAGCGGTCGTACCAGGACCCCTCCACGGTGATCACCACGTACGAAGGGCAGCACACG
CACCACAGCCCGGCGAGCCTCCGCGGCGGCGGCGGCGGCGTCGGCATCGTCGGAGGGCAC
CACCACCACCACCTCTTCATGCCCGGCGTGCATGGCCTGCCGCCGTCGCACCTCATGCCG
GCGGGGTTCCACCCTGAGCTGATGGGCCTCATGCACCACCACCCGGCCATGGCCGCCGCC
GCCGCAAACCCTAGCATGTACTTCCCGGGCGTAGCTGCTTCTGCTCCGCCGCCTCCTGCT
GTGGCTGGCGGCGGTGCAATGCCGCCCAACGATCATCCTCCTCTTCAGCAGCATCACTTC
ACTGACTACGCCCTGCTGCAAGACCTTTTCCCTTCCACAATGCCCAGCAGCAACCCATGA

Protein

380 aa

>Os01t0626400-01 WRKY transcription factor, Control of flowering time and plant height
MSSGGGGGGGGDRHGPYHQHGHLGRGEGADYVYSSSDMESFFFSQPGGVGIGGGGGGVVG
AGGADEIMPYSSITDYLQGLLDPSGLARHLDVACPSSQDTVVKQELSVDVTSHDSQGTGG
VAGEGVAQATPNSSASFSSSDGEAEGGKSSRRCKKGQAKAEEEDDKDEEDGENSKKPNKP
KKKAEKRQRQPRVAFLTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTPKCGVKKR
VERSYQDPSTVITTYEGQHTHHSPASLRGGGGGVGIVGGHHHHHLFMPGVHGLPPSHLMP
AGFHPELMGLMHHHPAMAAAAANPSMYFPGVAASAPPPPAVAGGGAMPPNDHPPLQQHHF
TDYALLQDLFPSTMPSSNP*

5'UTR

chr01:25009514..25009545 (+ strand) : 32 bp

CDS

chr01:25009546..25010075 (+ strand) : 530 bp

chr01:25010996..25011139 (+ strand) : 144 bp

chr01:25011303..25011768 (+ strand) : 466 bp

3'UTR

chr01:25011769..25011916 (+ strand) : 148 bp

chr01:25012062..25012233 (+ strand) : 172 bp

FASTA

>Os01t0626400-01 class=Sequence position=chr01:25009514..25012233 (+ strand)
ACATAAGCTA GCTCCCCATA CTCTCACACC CCATGTCTTC TGGAGGAGGA GGAGGAGGAG GAGGAGATCG CCATGGCCCC
TACCACCAGC ACGGGCACCT CGGCCGCGGC GAAGGCGCTG ATTACGTGTA CAGCAGCAGC GACATGGAGA GCTTCTTCTT
CAGCCAACCC GGGGGCGTCG GCATCGGCGG GGGTGGTGGT GGCGTCGTCG GCGCCGGCGG TGCCGACGAG ATCATGCCGT
ACTCCAGCAT CACGGACTAC CTGCAGGGGT TATTGGACCC CTCCGGGCTA GCTCGGCACC TCGACGTGGC GTGCCCGTCG
TCTCAGGACA CGGTGGTCAA GCAGGAGCTG TCGGTGGATG TGACGAGcca cgacagccag ggcaccggcg gcgtcgccgg
agaaggcgtc gcgcaggcca cgccgaactc gtcggcgtcc ttctcgtccA GCGACGGAGA GGCGGAGGGC GGCAAATCGT
CACGCCGGTG CAAGAAGGGT CAGGCGAAGG CGGAGGAGGA GGACGACAAG GATGAGGAGG ATGGAGAGAA CTCCAAGAAA
CCGTATGTTA AATTTCCATT GATTCTACTC TATACTTTGT CTGATTCTTG TCTTGATTTC TTGCTTGATT AATTCTTTTT
TGATGCGTGT CTTGAGATGG GGATACTTTC TTGGGGCTAG ATCTGGTTGG TCATACTGTT GCGGAGTTGC AAAATTTGAC
CTGAAATTTT CTTTCGTTTA TGCTTTCTCT CTACTGCATG CATGGTGTGA ACATTAGGGT TTGCTAGAAT TTTGGTTCCT
TAGGGTTCTT TTTAGTAGAT CCGTCTATCC TCTTGTTCCC CTTTTCTTCT GATTCCGTTT TGACCCAATT TCCAATATGA
TCTTTCAGAC GATGGGGCTA CTACTATTCG ATTTAATTTA ATAGACAACC AACCTATGCT CCATAATAGA TCTTGCGTAG
AATGAATCAA TTTTACGAGT TATAGCTTCA ATTTTTGACT TGCTAGGTCT TTGAAGATTA TATTATGATT TCCCCTTTTA
GAAATGATTC AAATTAAGAT ATATTTTCGT ATCACCACCA ACCACCTAAA TCTACAATAG TTCCTCAGTA CTTTTGCAAA
ATTAACGCTG ATCTTGCCCC ATAACATGCA ATCCAACAGA TATCTAGCTA GCTAGCTAAC TTATTAGACC CTAATTAATA
CTATATATCA AAATAACAAC TATTTCTAGC AAAACCTGGT GCTAATCTAA CATGAAATAG CTAGCTATTC CCATAGTCCA
CCATGATCCT ACCTATCTAG CAAGCTAGTT AGCTAGTTTG ATTGTTGGTG CTCTGAAAAA GCCCAAACTA ATTAATAATT
AGGCCTGATT GAGCTTGTCA CCGCAGAAAT ATCAACTGAT CTTCTGAATC CATATCATCT CTCTGTTTCT AGCTAATCCA
CCTGACCTTA TTTTTGATAT TTTGTACCAT GCATCTACAC AGGAACAAGC CCAAGAAGAA AGCTGAGAAG AGGCAGCGGC
AGCCTCGCGT GGCGTTCCTC ACCAAGAGCG AGGTTGATCA CCTCGAGGAC GGCTACCGGT GGCGCAAGTA CGGCCAGAAG
GCAGTCAAGA ACAGCCCATA CCCGAGGTAC ACATCTATAT ACATGTACAA ACCTTAATTT CACCCAGTTG TTGTAGCACA
TACATATATC GTAGTATACC ATGTTACTGT GCCATACAAT TGCATGGCAC GATGGTGTTC AAGTACTCCA ATTTCAAAAT
GCAATTCAAT TCGAATTCGA ATATTGCAGG AGCTACTACC GGTGCACGAC GCCCAAGTGC GGTGTGAAGA AGCGGGTGGA
GCGGTCGTAC CAGGACCCCT CCACGGTGAT CACCACGTAC GAAGGGCAGC ACACGCACCA CAGCCCGGCG AGCCTCCGCG
GCGGCGGCGG CGGCGTCGGC ATCGTCGGAG GGCACCACCA CCACCACCTC TTCATGCCCG GCGTGCATGG CCTGCCGCCG
TCGCACCTCA TGCCGGCGGG GTTCCACCCT GAGCTGATGG GCCTCATGCA CCACCACCCG GCCATGGCCG CCGCCGCCGC
AAACCCTAGC ATGTACTTCC CGGGCGTAGC TGCTTCTGCT CCGCCGCCTC CTGCTGTGGC TGGCGGCGGT GCAATGCCGC
CCAACGATCA TCCTCCTCTT CAGCAGCATC ACTTCACTGA CTACGCCCTG CTGCAAGACC TTTTCCCTTC CACAATGCCC
AGCAGCAACC CATGATGATG ACTGATCTAA CTGATTCTGC ACAAATATAT ACTACTCAAT ATTTAACTAG CACCCGGAAT
TTATCAAGAT GCTTTTCAAA CATTGGAGTC GTTGCGCCAA AAATGTGATG GCTAGGGAGT GCTTGATGAT CAGCTTGGTC
TTGGTGAGAA TATATAATTG TTATTAATTA ATTGATTTTC TGCAAGCTTT TCATCTTGAA CGTAACTTGT GTGTGTTGTG
CACTTCATGC TTTTTTCTCT CTTCCATTTG TCAACATTTC CCTGGTTGCA AATTGAACGG ATCAGTAGAG ATGGAAGCTA
CAACTTTATA ACTAGAACGG CTGCATTCCA CTTGATTCTT CAGCATAGCC CTTTACTGTT CTGCACCTCT AGACTTATTG
TACATGCATG TACTAGTGTA TATCATGTGT ACCTCATTGA CTCATTTTCG GAGAGAGCAA ATTAATTAAT ATTTCGTCTC