Os01t0626400-02

Locus

Os01g0626400

Description

WRKY transcription factor, Splicing variant

RAP-DB Gene Symbol Synonym(s)

WRKY11, OsWRKY11.2

RAP-DB Gene Name Synonym(s)

WRKY GENE11

CGSNL Gene Symbol

WRKY11

CGSNL Gene Name

WRKY GENE11

Oryzabase Gene Symbol Synonym(s)

OsWRKY11, Dlf1, OsWRKY11.1, OsWRKY11.2

Oryzabase Gene Name Synonym(s)

Rice WRKY gene11, semidwarf and late flowering 1

Transcript Evidence

Inferred from literature (Zhonghua 11)

Protein Evidence

Inferred from literature

Literature

PMID: 25036785

Note

Manual Curation

December 1, 2016

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: transcription factor activity, sequence-specific DNA binding (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

WRKY domain (IPR003657)

Others

Oryzabase (6522)

Transcript

813 bp

>Os01t0626400-02 WRKY transcription factor, Splicing variant
ATGTCTTCTGGAGGAGGAGGAGGAGGAGGAGGAGATCGCCATGGCCCCTACCACCAGCAC
GGGCACCTCGGCCGCGGCGAAGGCGCTGATTACGTGTACAGCAGCAGCGACATGGAGAGC
TTCTTCTTCAGCCAACCCGGGGGCGTCGGCATCGGCGGGGGTGGTGGTGGCGTCGTCGGC
GCCGGCGGTGCCGACGAGATCATGCCGTACTCCAGCATCACGGACTACCTGCAGGGGTTA
TTGGACCCCTCCGGGCTAGCTCGGCACCTCGACGTGGCGTGCCCGTCGTCTCAGGACACG
GTGGTCAAGCAGGAGCTGTCGGTGGATGTGACGAGccacgacagccagggcaccggcggc
gtcgccggagaaggcgtcgcgcaggccacgccgaactcgtcggcgtccttctcgtccAGC
GACGGAGAGGCGGAGGGCGGCAAATCGTCACGCCGGTGCAAGAAGGGTCAGGCGAAGGCG
GAGGAGGAGGACGACAAGGATGAGGAGGATGGAGAGAACTCCAAGAAACCGAACAAGCCC
AAGAAGAAAGCTGAGAAGAGGCAGCGGCAGCCTCGCGTGGCGTTCCTCACCAAGAGCGAG
GTTGATCACCTCGAGGACGGCTACCGGTGGCGCAAGTACGGCCAGAAGGCAGTCAAGAAC
AGCCCATACCCGAGGAGCTACTACCGGTGCACGACGCCCAAGTGCGGTGTGAAGAAGCGG
GTGGAGCGGTCGTACCAGGACCCCTCCACGGTGATCACCACGTACGAAGGGCAGCACACG
CACCACAGCCCGGCGAGCCGCCGCAAACCCTAG

CDS

813 bp

>Os01t0626400-02 WRKY transcription factor, Splicing variant
ATGTCTTCTGGAGGAGGAGGAGGAGGAGGAGGAGATCGCCATGGCCCCTACCACCAGCAC
GGGCACCTCGGCCGCGGCGAAGGCGCTGATTACGTGTACAGCAGCAGCGACATGGAGAGC
TTCTTCTTCAGCCAACCCGGGGGCGTCGGCATCGGCGGGGGTGGTGGTGGCGTCGTCGGC
GCCGGCGGTGCCGACGAGATCATGCCGTACTCCAGCATCACGGACTACCTGCAGGGGTTA
TTGGACCCCTCCGGGCTAGCTCGGCACCTCGACGTGGCGTGCCCGTCGTCTCAGGACACG
GTGGTCAAGCAGGAGCTGTCGGTGGATGTGACGAGccacgacagccagggcaccggcggc
gtcgccggagaaggcgtcgcgcaggccacgccgaactcgtcggcgtccttctcgtccAGC
GACGGAGAGGCGGAGGGCGGCAAATCGTCACGCCGGTGCAAGAAGGGTCAGGCGAAGGCG
GAGGAGGAGGACGACAAGGATGAGGAGGATGGAGAGAACTCCAAGAAACCGAACAAGCCC
AAGAAGAAAGCTGAGAAGAGGCAGCGGCAGCCTCGCGTGGCGTTCCTCACCAAGAGCGAG
GTTGATCACCTCGAGGACGGCTACCGGTGGCGCAAGTACGGCCAGAAGGCAGTCAAGAAC
AGCCCATACCCGAGGAGCTACTACCGGTGCACGACGCCCAAGTGCGGTGTGAAGAAGCGG
GTGGAGCGGTCGTACCAGGACCCCTCCACGGTGATCACCACGTACGAAGGGCAGCACACG
CACCACAGCCCGGCGAGCCGCCGCAAACCCTAG

Protein

271 aa

>Os01t0626400-02 WRKY transcription factor, Splicing variant
MSSGGGGGGGGDRHGPYHQHGHLGRGEGADYVYSSSDMESFFFSQPGGVGIGGGGGGVVG
AGGADEIMPYSSITDYLQGLLDPSGLARHLDVACPSSQDTVVKQELSVDVTSHDSQGTGG
VAGEGVAQATPNSSASFSSSDGEAEGGKSSRRCKKGQAKAEEEDDKDEEDGENSKKPNKP
KKKAEKRQRQPRVAFLTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTPKCGVKKR
VERSYQDPSTVITTYEGQHTHHSPASRRKP*

CDS

chr01:25009546..25010075 (+ strand) : 530 bp

chr01:25010996..25011139 (+ strand) : 144 bp

chr01:25011303..25011427 (+ strand) : 125 bp

chr01:25011589..25011602 (+ strand) : 14 bp

FASTA

>Os01t0626400-02 class=Sequence position=chr01:25009546..25011602 (+ strand)
ATGTCTTCTG GAGGAGGAGG AGGAGGAGGA GGAGATCGCC ATGGCCCCTA CCACCAGCAC GGGCACCTCG GCCGCGGCGA
AGGCGCTGAT TACGTGTACA GCAGCAGCGA CATGGAGAGC TTCTTCTTCA GCCAACCCGG GGGCGTCGGC ATCGGCGGGG
GTGGTGGTGG CGTCGTCGGC GCCGGCGGTG CCGACGAGAT CATGCCGTAC TCCAGCATCA CGGACTACCT GCAGGGGTTA
TTGGACCCCT CCGGGCTAGC TCGGCACCTC GACGTGGCGT GCCCGTCGTC TCAGGACACG GTGGTCAAGC AGGAGCTGTC
GGTGGATGTG ACGAGccacg acagccaggg caccggcggc gtcgccggag aaggcgtcgc gcaggccacg ccgaactcgt
cggcgtcctt ctcgtccAGC GACGGAGAGG CGGAGGGCGG CAAATCGTCA CGCCGGTGCA AGAAGGGTCA GGCGAAGGCG
GAGGAGGAGG ACGACAAGGA TGAGGAGGAT GGAGAGAACT CCAAGAAACC GTATGTTAAA TTTCCATTGA TTCTACTCTA
TACTTTGTCT GATTCTTGTC TTGATTTCTT GCTTGATTAA TTCTTTTTTG ATGCGTGTCT TGAGATGGGG ATACTTTCTT
GGGGCTAGAT CTGGTTGGTC ATACTGTTGC GGAGTTGCAA AATTTGACCT GAAATTTTCT TTCGTTTATG CTTTCTCTCT
ACTGCATGCA TGGTGTGAAC ATTAGGGTTT GCTAGAATTT TGGTTCCTTA GGGTTCTTTT TAGTAGATCC GTCTATCCTC
TTGTTCCCCT TTTCTTCTGA TTCCGTTTTG ACCCAATTTC CAATATGATC TTTCAGACGA TGGGGCTACT ACTATTCGAT
TTAATTTAAT AGACAACCAA CCTATGCTCC ATAATAGATC TTGCGTAGAA TGAATCAATT TTACGAGTTA TAGCTTCAAT
TTTTGACTTG CTAGGTCTTT GAAGATTATA TTATGATTTC CCCTTTTAGA AATGATTCAA ATTAAGATAT ATTTTCGTAT
CACCACCAAC CACCTAAATC TACAATAGTT CCTCAGTACT TTTGCAAAAT TAACGCTGAT CTTGCCCCAT AACATGCAAT
CCAACAGATA TCTAGCTAGC TAGCTAACTT ATTAGACCCT AATTAATACT ATATATCAAA ATAACAACTA TTTCTAGCAA
AACCTGGTGC TAATCTAACA TGAAATAGCT AGCTATTCCC ATAGTCCACC ATGATCCTAC CTATCTAGCA AGCTAGTTAG
CTAGTTTGAT TGTTGGTGCT CTGAAAAAGC CCAAACTAAT TAATAATTAG GCCTGATTGA GCTTGTCACC GCAGAAATAT
CAACTGATCT TCTGAATCCA TATCATCTCT CTGTTTCTAG CTAATCCACC TGACCTTATT TTTGATATTT TGTACCATGC
ATCTACACAG GAACAAGCCC AAGAAGAAAG CTGAGAAGAG GCAGCGGCAG CCTCGCGTGG CGTTCCTCAC CAAGAGCGAG
GTTGATCACC TCGAGGACGG CTACCGGTGG CGCAAGTACG GCCAGAAGGC AGTCAAGAAC AGCCCATACC CGAGGTACAC
ATCTATATAC ATGTACAAAC CTTAATTTCA CCCAGTTGTT GTAGCACATA CATATATCGT AGTATACCAT GTTACTGTGC
CATACAATTG CATGGCACGA TGGTGTTCAA GTACTCCAAT TTCAAAATGC AATTCAATTC GAATTCGAAT ATTGCAGGAG
CTACTACCGG TGCACGACGC CCAAGTGCGG TGTGAAGAAG CGGGTGGAGC GGTCGTACCA GGACCCCTCC ACGGTGATCA
CCACGTACGA AGGGCAGCAC ACGCACCACA GCCCGGCGAG CCTCCGCGGC GGCGGCGGCG GCGTCGGCAT CGTCGGAGGG
CACCACCACC ACCACCTCTT CATGCCCGGC GTGCATGGCC TGCCGCCGTC GCACCTCATG CCGGCGGGGT TCCACCCTGA
GCTGATGGGC CTCATGCACC ACCACCCGGC CATGGCCGCC GCCGCCGCAA ACCCTAG