Os01t0630200-00

Locus

Os01g0630200

Description

Similar to oligopeptide transporter OPT family.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

ab initio prediction

Protein Evidence

XP_002313213.1 (RefSeq)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Functional domain (InterPro)

Tetrapeptide transporter, OPT1/isp4 (IPR004648)

Oligopeptide transporter OPT superfamily (IPR004813)

Expression Databases

TENOR (Os01t0630200-00)

Transcript

2268 bp

>Os01t0630200-00 Similar to oligopeptide transporter OPT family.
ATGGGCGAGGGCGAGTTCGTCGACGTCGAGCGCGGCGTGGTCGCTGAAGGGGCGTTGGAC
GACGACGCGTCGCCGATCGAGGAGGTCCGGCTGACGGTTCCGGTCACTGACGACTCGTCC
CTTCCGGTGTGGACGTTCCGGATGTGGACACTCGGCCTGCTCTCGTGCGTGCTCATGAGC
TTCCTGAACCAGTTCTTCTCCTACCGCACCGAGCCGCTCATCGTCACCCAGATCACCGTG
CAGGTGGCCTCGCTGCCTCTGGGCCACATCCTCGCCCGCGTGCTGCCGCGCCGCAAGTTC
AAGGCCCCCGCGCTGCTCGGCGGCGGGGAGTGCAGCCTCAACCCGGGGCCCTTCAACATG
AAGGAGCACGTGCTCGTCTCCATCTTCGCCAACGCCGGCTGCGCCTTCGGCAGCGGGTCC
GCCTACGCCGTCATGATCGTCGACATCATCCGCGCCTTCTACGGGCGGTCCATCTCCCTC
TTCCCCGCATGGCTCCTCATCACCACCACGCAGGTGCTCGGCTACGGGTGGGCGGGGCTG
ATGCGCAGGTACGTGGTGGAGCCGGCGCAAATGTGGTGGCCCGGCACGCTCGTGCAGGTG
TCGCTGTTCAGGGCGCTGCACGGGAAGGGGGAAGAGAAGGAGGAGAATAAGGAGGGCAGC
GGCGGCGGGATGTCTCAGGCCAAGTTCTTCCTGATCGCGCTCGCCTGCAGCTTCCTGTGG
TACGCCGTGCCGGGTTACCTGTTCCCGACGCTGACCTCCGTCTCGTGGGTCTGCTGGATC
TTCTCCAAGTCCGTCACGGCGCAGCAGCTGGGCTCCGGCATGAAGGGCCTGGGCCTCGGC
GCCTTCACCCTCGACTGGACGGCCGTGTCAGCCTTCCTGTACAGCCCGCTGATCTCGCCG
TTCTTTGCCACCGCCAACATCTTGGCCGGCTACGTGCTCCTGATGTACGTGGTCGTGCCG
GTGTCGTACTGGGGCCTCGACCTGTACAACGCCCGGAGGTTCCCCATCTTCTCGTCGCAC
CTGTTCACGGCCACCGGCAGCACATACGACATCACGGCCATCGTGAACGACCGCTTCGAG
ATCGACATGGACGGGTACCATCGGATGGGGCGGATCAACATGAGCACGTTCTTTGCGCTG
TCCTACGGGCTCGGCTTCGCGACGATCGCGGCCACCGTCACGCACGTGGCGCTGTTCCAC
GGGAAGGAGATCTACCGCCGGTTCCGCGCGTCGCAGAGGGACAAGCCCGACGTGCACACG
AGGCTGATGAAGAGCTACCGCGACGTGCCGAGCTGGTGGTTCTACGCGATGCTCGCGCTG
TCCATGGCCGTCTCGCTCTTGCTCTGCACCGTCCTCAGGTCGGCGGTGCAGCTCCCGTGG
TGGGGTCTCCTCTTCGCCTGCGCCATGGCCTTCGTGTTCACGCTGCCGATCAGCATCATC
ACGGCCACGACCAACCAGACGCCAGGGCTCAACATCATCACCGAGTACGTCATCGGGCTC
ATGCTTCCGGGCAAGCCCATCGCCAACGTCTGCTTCAAGGCGTACGGCTACATGAGCATG
TCGCAGGCCGTGTCCTTCCTGTCCGACTTCAAGCTCGGCCACTACATGAAGATACCCCCC
AAGTCCATGTTCCTCGTGAAGTTGGTCGGCACGGTGGTCGCCTCCACGGTCAACCTCGTG
GTGGCGTACTGGCTGCTGGGTTCCATCCCCAACATCTGCCAGGACGCGCTCCTCCCGGCG
GATAGCCCGTGGACGTGCCCGAACGACCGCGTCTTCTTCGACGCGTCCGTCATCTGGGGC
CTCGTCGGGCCGCGCCGCATCTTCGGGCCACTCGGCAACTACGGCGCGCTCAATTGGTTC
TTCCTCGCTGGCGCCGTGGGACCCGTCATTGTGTACTTGCTCCACAGGGCGTTCCCCAGC
AAGACCTGGATACCGATGATCAACCTGCCGGTGCTCATCGGAGCGACCTCCTACATGCCG
CCGGCAACGGCCGTGAACTACAACTCCTGGCTGATCATCGGGATCATCTTCAACTTCTTC
GTTTTCCGGTACAGGAAGCTGTGGTGGAAGAGGTACAACTACATCCTCTCGGCTGCGCTC
GACGCCGGCGTCGCGTTCATGGCGGTGCTGCTCTACTTCTCGCTGTCGATGGAGAACCGG
AGCATCAGCTGGTGGGGTACGGCCGGCGAGCACTGCCCGCTGGCCTCATGCCCTACCGCC
AAAGGGATAAACTTGGGCGCTGATAGCGTCTGCCCTGTTGTGTTATAA

CDS

2268 bp

>Os01t0630200-00 Similar to oligopeptide transporter OPT family.
ATGGGCGAGGGCGAGTTCGTCGACGTCGAGCGCGGCGTGGTCGCTGAAGGGGCGTTGGAC
GACGACGCGTCGCCGATCGAGGAGGTCCGGCTGACGGTTCCGGTCACTGACGACTCGTCC
CTTCCGGTGTGGACGTTCCGGATGTGGACACTCGGCCTGCTCTCGTGCGTGCTCATGAGC
TTCCTGAACCAGTTCTTCTCCTACCGCACCGAGCCGCTCATCGTCACCCAGATCACCGTG
CAGGTGGCCTCGCTGCCTCTGGGCCACATCCTCGCCCGCGTGCTGCCGCGCCGCAAGTTC
AAGGCCCCCGCGCTGCTCGGCGGCGGGGAGTGCAGCCTCAACCCGGGGCCCTTCAACATG
AAGGAGCACGTGCTCGTCTCCATCTTCGCCAACGCCGGCTGCGCCTTCGGCAGCGGGTCC
GCCTACGCCGTCATGATCGTCGACATCATCCGCGCCTTCTACGGGCGGTCCATCTCCCTC
TTCCCCGCATGGCTCCTCATCACCACCACGCAGGTGCTCGGCTACGGGTGGGCGGGGCTG
ATGCGCAGGTACGTGGTGGAGCCGGCGCAAATGTGGTGGCCCGGCACGCTCGTGCAGGTG
TCGCTGTTCAGGGCGCTGCACGGGAAGGGGGAAGAGAAGGAGGAGAATAAGGAGGGCAGC
GGCGGCGGGATGTCTCAGGCCAAGTTCTTCCTGATCGCGCTCGCCTGCAGCTTCCTGTGG
TACGCCGTGCCGGGTTACCTGTTCCCGACGCTGACCTCCGTCTCGTGGGTCTGCTGGATC
TTCTCCAAGTCCGTCACGGCGCAGCAGCTGGGCTCCGGCATGAAGGGCCTGGGCCTCGGC
GCCTTCACCCTCGACTGGACGGCCGTGTCAGCCTTCCTGTACAGCCCGCTGATCTCGCCG
TTCTTTGCCACCGCCAACATCTTGGCCGGCTACGTGCTCCTGATGTACGTGGTCGTGCCG
GTGTCGTACTGGGGCCTCGACCTGTACAACGCCCGGAGGTTCCCCATCTTCTCGTCGCAC
CTGTTCACGGCCACCGGCAGCACATACGACATCACGGCCATCGTGAACGACCGCTTCGAG
ATCGACATGGACGGGTACCATCGGATGGGGCGGATCAACATGAGCACGTTCTTTGCGCTG
TCCTACGGGCTCGGCTTCGCGACGATCGCGGCCACCGTCACGCACGTGGCGCTGTTCCAC
GGGAAGGAGATCTACCGCCGGTTCCGCGCGTCGCAGAGGGACAAGCCCGACGTGCACACG
AGGCTGATGAAGAGCTACCGCGACGTGCCGAGCTGGTGGTTCTACGCGATGCTCGCGCTG
TCCATGGCCGTCTCGCTCTTGCTCTGCACCGTCCTCAGGTCGGCGGTGCAGCTCCCGTGG
TGGGGTCTCCTCTTCGCCTGCGCCATGGCCTTCGTGTTCACGCTGCCGATCAGCATCATC
ACGGCCACGACCAACCAGACGCCAGGGCTCAACATCATCACCGAGTACGTCATCGGGCTC
ATGCTTCCGGGCAAGCCCATCGCCAACGTCTGCTTCAAGGCGTACGGCTACATGAGCATG
TCGCAGGCCGTGTCCTTCCTGTCCGACTTCAAGCTCGGCCACTACATGAAGATACCCCCC
AAGTCCATGTTCCTCGTGAAGTTGGTCGGCACGGTGGTCGCCTCCACGGTCAACCTCGTG
GTGGCGTACTGGCTGCTGGGTTCCATCCCCAACATCTGCCAGGACGCGCTCCTCCCGGCG
GATAGCCCGTGGACGTGCCCGAACGACCGCGTCTTCTTCGACGCGTCCGTCATCTGGGGC
CTCGTCGGGCCGCGCCGCATCTTCGGGCCACTCGGCAACTACGGCGCGCTCAATTGGTTC
TTCCTCGCTGGCGCCGTGGGACCCGTCATTGTGTACTTGCTCCACAGGGCGTTCCCCAGC
AAGACCTGGATACCGATGATCAACCTGCCGGTGCTCATCGGAGCGACCTCCTACATGCCG
CCGGCAACGGCCGTGAACTACAACTCCTGGCTGATCATCGGGATCATCTTCAACTTCTTC
GTTTTCCGGTACAGGAAGCTGTGGTGGAAGAGGTACAACTACATCCTCTCGGCTGCGCTC
GACGCCGGCGTCGCGTTCATGGCGGTGCTGCTCTACTTCTCGCTGTCGATGGAGAACCGG
AGCATCAGCTGGTGGGGTACGGCCGGCGAGCACTGCCCGCTGGCCTCATGCCCTACCGCC
AAAGGGATAAACTTGGGCGCTGATAGCGTCTGCCCTGTTGTGTTATAA

Protein

756 aa

>Os01t0630200-00 Similar to oligopeptide transporter OPT family.
MGEGEFVDVERGVVAEGALDDDASPIEEVRLTVPVTDDSSLPVWTFRMWTLGLLSCVLMS
FLNQFFSYRTEPLIVTQITVQVASLPLGHILARVLPRRKFKAPALLGGGECSLNPGPFNM
KEHVLVSIFANAGCAFGSGSAYAVMIVDIIRAFYGRSISLFPAWLLITTTQVLGYGWAGL
MRRYVVEPAQMWWPGTLVQVSLFRALHGKGEEKEENKEGSGGGMSQAKFFLIALACSFLW
YAVPGYLFPTLTSVSWVCWIFSKSVTAQQLGSGMKGLGLGAFTLDWTAVSAFLYSPLISP
FFATANILAGYVLLMYVVVPVSYWGLDLYNARRFPIFSSHLFTATGSTYDITAIVNDRFE
IDMDGYHRMGRINMSTFFALSYGLGFATIAATVTHVALFHGKEIYRRFRASQRDKPDVHT
RLMKSYRDVPSWWFYAMLALSMAVSLLLCTVLRSAVQLPWWGLLFACAMAFVFTLPISII
TATTNQTPGLNIITEYVIGLMLPGKPIANVCFKAYGYMSMSQAVSFLSDFKLGHYMKIPP
KSMFLVKLVGTVVASTVNLVVAYWLLGSIPNICQDALLPADSPWTCPNDRVFFDASVIWG
LVGPRRIFGPLGNYGALNWFFLAGAVGPVIVYLLHRAFPSKTWIPMINLPVLIGATSYMP
PATAVNYNSWLIIGIIFNFFVFRYRKLWWKRYNYILSAALDAGVAFMAVLLYFSLSMENR
SISWWGTAGEHCPLASCPTAKGINLGADSVCPVVL*

CDS

chr01:25187250..25189517 (+ strand) : 2268 bp

FASTA

>Os01t0630200-00 class=Sequence position=chr01:25187250..25189517 (+ strand)
ATGGGCGAGG GCGAGTTCGT CGACGTCGAG CGCGGCGTGG TCGCTGAAGG GGCGTTGGAC GACGACGCGT CGCCGATCGA
GGAGGTCCGG CTGACGGTTC CGGTCACTGA CGACTCGTCC CTTCCGGTGT GGACGTTCCG GATGTGGACA CTCGGCCTGC
TCTCGTGCGT GCTCATGAGC TTCCTGAACC AGTTCTTCTC CTACCGCACC GAGCCGCTCA TCGTCACCCA GATCACCGTG
CAGGTGGCCT CGCTGCCTCT GGGCCACATC CTCGCCCGCG TGCTGCCGCG CCGCAAGTTC AAGGCCCCCG CGCTGCTCGG
CGGCGGGGAG TGCAGCCTCA ACCCGGGGCC CTTCAACATG AAGGAGCACG TGCTCGTCTC CATCTTCGCC AACGCCGGCT
GCGCCTTCGG CAGCGGGTCC GCCTACGCCG TCATGATCGT CGACATCATC CGCGCCTTCT ACGGGCGGTC CATCTCCCTC
TTCCCCGCAT GGCTCCTCAT CACCACCACG CAGGTGCTCG GCTACGGGTG GGCGGGGCTG ATGCGCAGGT ACGTGGTGGA
GCCGGCGCAA ATGTGGTGGC CCGGCACGCT CGTGCAGGTG TCGCTGTTCA GGGCGCTGCA CGGGAAGGGG GAAGAGAAGG
AGGAGAATAA GGAGGGCAGC GGCGGCGGGA TGTCTCAGGC CAAGTTCTTC CTGATCGCGC TCGCCTGCAG CTTCCTGTGG
TACGCCGTGC CGGGTTACCT GTTCCCGACG CTGACCTCCG TCTCGTGGGT CTGCTGGATC TTCTCCAAGT CCGTCACGGC
GCAGCAGCTG GGCTCCGGCA TGAAGGGCCT GGGCCTCGGC GCCTTCACCC TCGACTGGAC GGCCGTGTCA GCCTTCCTGT
ACAGCCCGCT GATCTCGCCG TTCTTTGCCA CCGCCAACAT CTTGGCCGGC TACGTGCTCC TGATGTACGT GGTCGTGCCG
GTGTCGTACT GGGGCCTCGA CCTGTACAAC GCCCGGAGGT TCCCCATCTT CTCGTCGCAC CTGTTCACGG CCACCGGCAG
CACATACGAC ATCACGGCCA TCGTGAACGA CCGCTTCGAG ATCGACATGG ACGGGTACCA TCGGATGGGG CGGATCAACA
TGAGCACGTT CTTTGCGCTG TCCTACGGGC TCGGCTTCGC GACGATCGCG GCCACCGTCA CGCACGTGGC GCTGTTCCAC
GGGAAGGAGA TCTACCGCCG GTTCCGCGCG TCGCAGAGGG ACAAGCCCGA CGTGCACACG AGGCTGATGA AGAGCTACCG
CGACGTGCCG AGCTGGTGGT TCTACGCGAT GCTCGCGCTG TCCATGGCCG TCTCGCTCTT GCTCTGCACC GTCCTCAGGT
CGGCGGTGCA GCTCCCGTGG TGGGGTCTCC TCTTCGCCTG CGCCATGGCC TTCGTGTTCA CGCTGCCGAT CAGCATCATC
ACGGCCACGA CCAACCAGAC GCCAGGGCTC AACATCATCA CCGAGTACGT CATCGGGCTC ATGCTTCCGG GCAAGCCCAT
CGCCAACGTC TGCTTCAAGG CGTACGGCTA CATGAGCATG TCGCAGGCCG TGTCCTTCCT GTCCGACTTC AAGCTCGGCC
ACTACATGAA GATACCCCCC AAGTCCATGT TCCTCGTGAA GTTGGTCGGC ACGGTGGTCG CCTCCACGGT CAACCTCGTG
GTGGCGTACT GGCTGCTGGG TTCCATCCCC AACATCTGCC AGGACGCGCT CCTCCCGGCG GATAGCCCGT GGACGTGCCC
GAACGACCGC GTCTTCTTCG ACGCGTCCGT CATCTGGGGC CTCGTCGGGC CGCGCCGCAT CTTCGGGCCA CTCGGCAACT
ACGGCGCGCT CAATTGGTTC TTCCTCGCTG GCGCCGTGGG ACCCGTCATT GTGTACTTGC TCCACAGGGC GTTCCCCAGC
AAGACCTGGA TACCGATGAT CAACCTGCCG GTGCTCATCG GAGCGACCTC CTACATGCCG CCGGCAACGG CCGTGAACTA
CAACTCCTGG CTGATCATCG GGATCATCTT CAACTTCTTC GTTTTCCGGT ACAGGAAGCT GTGGTGGAAG AGGTACAACT
ACATCCTCTC GGCTGCGCTC GACGCCGGCG TCGCGTTCAT GGCGGTGCTG CTCTACTTCT CGCTGTCGAT GGAGAACCGG
AGCATCAGCT GGTGGGGTAC GGCCGGCGAG CACTGCCCGC TGGCCTCATG CCCTACCGCC AAAGGGATAA ACTTGGGCGC
TGATAGCGTC TGCCCTGTTG TGTTATAA

Locus: Os01g0630200

Loading...

Locus: Os01g0630200

Loading...