Os01t0633500-01

Locus

Os01g0633500

Description

Dihydroflavonol-4-reductase (DFR), Proanthocyanidin synthesis

RAP-DB Gene Symbol Synonym(s)

Rd, DFR

RAP-DB Gene Name Synonym(s)

red pericarp and seed coat, dihydroflavonol 4-reductase

CGSNL Gene Symbol

RD

CGSNL Gene Name

RED PERICARP AND SEED COAT

Oryzabase Gene Symbol Synonym(s)

Rd, DFR, OsDFR, OS-DFR

Oryzabase Gene Name Synonym(s)

Red pericarp and seed coat, dihydroflavonol 4-reductase, dihydroflavonol-4-reductase

Transcript Evidence

AB003496 (Murasaki-ine)

Inferred from literature

Protein Evidence

Q9S7C3

Literature

PMID: 17163879

DOI: org/10.5511/plantbiotechnology.15.221

Note

Manual Curation

June 26, 2018

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: coenzyme binding (GO:0050662)

Functional domain (InterPro)

NAD(P)-binding domain superfamily (IPR036291)

NAD-dependent epimerase/dehydratase (IPR001509)

Expression Databases

TENOR (Os01t0633500-00)

Others

Oryzabase (467)

Transcript

1466 bp

>Os01t0633500-01 Dihydroflavonol-4-reductase (DFR), Proanthocyanidin synthesis
TGCGAATCCAACACAAGCACCGCGGCGTAGTACTACTACTTGCGCGCGCGTGTTAGATTC
GCGTGCGAATCCAACACAAGCAGATCGATCACGCACGGTACGCCATGGGCGAGGCGGTGA
AGGGGCCAgtggtggtgacgggcgcgtcgggcttcgtcggctcatggctcgtcatgaagc
tcctccaggccggctacaccgtccgcgccacagtgcgcgacccctCTAACGTTGGGAAGA
CGAAGCCGTTGCTGGAGCTGGCGGGGTAGAAGGAGAGGCTGACGCTGTGGAAGGCCGACC
TGGGCGAGGAAGGCAGCTTCGACGCGGCGATCAGGGGTTGCACGGGCGTGTTCCACGTCG
CGACGCCCATGGACTTCGAGTCCGAGGACCCGGAGAACGAGGTGGTCAAGCCCACCGTGG
AAGGGATGCTGAGCATCATGCGGGCCTGCAGGGACGCCGGCACCGTCAAGCGCATCGTCT
TCACCTCCTCCGCCGGGACCGTCAACATCGAGGAGCGGCAGCGCCCCTCCTACGACCACG
ACGACTGGAGCGACATCGACTTCTGCCGCCGCGTCAAGATGACCGGATGGATGTACTTCG
TGTCCAAGTCATTGGCGGAGAAGGCCGCCATGGAATACGCGAGGGAGCACGGGCTGGACC
TCATCAGCGTCATCCCCACGCTCGTCGTCGGGCCCTTCATCAGCAACGGGATGCCGCCGA
GCCACGTCACCGCGCTGGCGCTGCTCACGGGGAACGAGGCCCACTACTCGATCCTGAAGC
AGGTGCAGTTCGTCCACCTCGACGACCTCTGCGACGCCGAGATCTTCCTCTTCGAGAGCC
CCGAGGCGCGCGGCCGCTACGTCTGCTCCTCCCACGACGCCACCATCCACGGCCTCGCGA
CGATGCTCGCGGACATGTTCCCGGAGTACGACGTGCCGCGGAGCTTTCCCGGGATCGACG
CCGACCACCTCCAGCCGGTGCACTTCTCGTCGTGGAAGCTCCTCGCCCACGGGTTCAGGT
TCAGGTACACGCTGGAGGACATGTTCGAGGCCGCCGTCCGGACGTGCAGGGAGAAGGGGC
TTCTCCCGCCGCTGCCGCCACCGCCGACGACGGCCGTGGCCGGAGGAGACGGCTCGGCGG
GTGTGGCCGGCGAGAAGGAACCGATACTGGGGAGGGGGACCGGGACGGCGGTTGGTGCTG
AAACAGAAGCGTTGGTCAAATGAGTGTTGACTAGTGAGTCCAGAGAACGGTATTGAAATT
GATCGTGTTTCGCTGCTCCTTGCCTCGTTGGCTTCGTCTATTTCACAATGCGAGATTTGG
AATAAATCAGAGCGGTTAATCCTGTAAGTTCATATGTAACGTACCCATTTGATTTTTTAT
TGGTTACATATGgttactccctccggtttcattttaattgacactttgaacaataatacg
ttttacaagatatacctttgacttta

CDS

855 bp

>Os01t0633500-01 Dihydroflavonol-4-reductase (DFR), Proanthocyanidin synthesis
ATGGACTTCGAGTCCGAGGACCCGGAGAACGAGGTGGTCAAGCCCACCGTGGAAGGGATG
CTGAGCATCATGCGGGCCTGCAGGGACGCCGGCACCGTCAAGCGCATCGTCTTCACCTCC
TCCGCCGGGACCGTCAACATCGAGGAGCGGCAGCGCCCCTCCTACGACCACGACGACTGG
AGCGACATCGACTTCTGCCGCCGCGTCAAGATGACCGGATGGATGTACTTCGTGTCCAAG
TCATTGGCGGAGAAGGCCGCCATGGAATACGCGAGGGAGCACGGGCTGGACCTCATCAGC
GTCATCCCCACGCTCGTCGTCGGGCCCTTCATCAGCAACGGGATGCCGCCGAGCCACGTC
ACCGCGCTGGCGCTGCTCACGGGGAACGAGGCCCACTACTCGATCCTGAAGCAGGTGCAG
TTCGTCCACCTCGACGACCTCTGCGACGCCGAGATCTTCCTCTTCGAGAGCCCCGAGGCG
CGCGGCCGCTACGTCTGCTCCTCCCACGACGCCACCATCCACGGCCTCGCGACGATGCTC
GCGGACATGTTCCCGGAGTACGACGTGCCGCGGAGCTTTCCCGGGATCGACGCCGACCAC
CTCCAGCCGGTGCACTTCTCGTCGTGGAAGCTCCTCGCCCACGGGTTCAGGTTCAGGTAC
ACGCTGGAGGACATGTTCGAGGCCGCCGTCCGGACGTGCAGGGAGAAGGGGCTTCTCCCG
CCGCTGCCGCCACCGCCGACGACGGCCGTGGCCGGAGGAGACGGCTCGGCGGGTGTGGCC
GGCGAGAAGGAACCGATACTGGGGAGGGGGACCGGGACGGCGGTTGGTGCTGAAACAGAA
GCGTTGGTCAAATGA

Protein

285 aa

>Os01t0633500-01 Dihydroflavonol-4-reductase (DFR), Proanthocyanidin synthesis
MDFESEDPENEVVKPTVEGMLSIMRACRDAGTVKRIVFTSSAGTVNIEERQRPSYDHDDW
SDIDFCRRVKMTGWMYFVSKSLAEKAAMEYAREHGLDLISVIPTLVVGPFISNGMPPSHV
TALALLTGNEAHYSILKQVQFVHLDDLCDAEIFLFESPEARGRYVCSSHDATIHGLATML
ADMFPEYDVPRSFPGIDADHLQPVHFSSWKLLAHGFRFRYTLEDMFEAAVRTCREKGLLP
PLPPPPTTAVAGGDGSAGVAGEKEPILGRGTGTAVGAETEALVK*

5'UTR

chr01:25382714..25382938 (+ strand) : 225 bp

chr01:25383051..25383193 (+ strand) : 143 bp

CDS

chr01:25383194..25383415 (+ strand) : 222 bp

chr01:25383803..25384435 (+ strand) : 633 bp

3'UTR

chr01:25384436..25384678 (+ strand) : 243 bp

FASTA

>Os01t0633500-01 class=Sequence position=chr01:25382714..25384678 (+ strand)
TGCGAATCCA ACACAAGCAC CGCGGCGTAG TACTACTACT TGCGCGCGCG TGTTAGATTC GCGTGCGAAT CCAACACAAG
CAGATCGATC ACGCACGGTA CGCCATGGGC GAGGCGGTGA AGGGGCCAgt ggtggtgacg ggcgcgtcgg gcttcgtcgg
ctcatggctc gtcatgaagc tcctccaggc cggctacacc gtccgcgcca cagtgcgcga cccctgtgag cTCTCTCATC
GTGCACTCTA GCTCTCTCCT CGTAGTTTAC TGACTCCAAT TATATATGCC GCTTGCTTGA CTCTGACAAG TGTACGTGTT
GTTGTTGTTG TTTTCAGCTA ACGTTGGGAA GACGAAGCCG TTGCTGGAGC TGGCGGGGTA GAAGGAGAGG CTGACGCTGT
GGAAGGCCGA CCTGGGCGAG GAAGGCAGCT TCGACGCGGC GATCAGGGGT TGCACGGGCG TGTTCCACGT CGCGACGCCC
ATGGACTTCG AGTCCGAGGA CCCGGAGAAC GAGGTGGTCA AGCCCACCGT GGAAGGGATG CTGAGCATCA TGCGGGCCTG
CAGGGACGCC GGCACCGTCA AGCGCATCGT CTTCACCTCC TCCGCCGGGA CCGTCAACAT CGAGGAGCGG CAGCGCCCCT
CCTACGACCA CGACGACTGG AGCGACATCG ACTTCTGCCG CCGCGTCAAG ATGACCGGAT GGGTATGTAT CGAAAATGTT
GTCGTGGGTT Aggaacaacg atcctccacg tacataaaac gaaacgataa gttaacatga gcatgattaa tattagtatg
gtataattga tatttgttta aaaatctaaa aaatattaat atgattttta aataactatt ttatagaatt ttttttatga
aaacacaagg aaacagaaat tgagaaatag tacgttcaaa ctcacccTTA AGCAACTGAA ACTAGCTTAG CACGTGAATT
TGGCCGTGTG AGTCATATGA TATGAAGGTC GGGGATGTTT TTTTTTTTTT TGCGGGGATG TAATTAACTA ATTATGTAAA
CCATTTCTAT TGTCTAAAAG AAGTTAGCAA GTGATAATTG TGGTGGCAGA TGTACTTCGT GTCCAAGTCA TTGGCGGAGA
AGGCCGCCAT GGAATACGCG AGGGAGCACG GGCTGGACCT CATCAGCGTC ATCCCCACGC TCGTCGTCGG GCCCTTCATC
AGCAACGGGA TGCCGCCGAG CCACGTCACC GCGCTGGCGC TGCTCACGGG GAACGAGGCC CACTACTCGA TCCTGAAGCA
GGTGCAGTTC GTCCACCTCG ACGACCTCTG CGACGCCGAG ATCTTCCTCT TCGAGAGCCC CGAGGCGCGC GGCCGCTACG
TCTGCTCCTC CCACGACGCC ACCATCCACG GCCTCGCGAC GATGCTCGCG GACATGTTCC CGGAGTACGA CGTGCCGCGG
AGCTTTCCCG GGATCGACGC CGACCACCTC CAGCCGGTGC ACTTCTCGTC GTGGAAGCTC CTCGCCCACG GGTTCAGGTT
CAGGTACACG CTGGAGGACA TGTTCGAGGC CGCCGTCCGG ACGTGCAGGG AGAAGGGGCT TCTCCCGCCG CTGCCGCCAC
CGCCGACGAC GGCCGTGGCC GGAGGAGACG GCTCGGCGGG TGTGGCCGGC GAGAAGGAAC CGATACTGGG GAGGGGGACC
GGGACGGCGG TTGGTGCTGA AACAGAAGCG TTGGTCAAAT GAGTGTTGAC TAGTGAGTCC AGAGAACGGT ATTGAAATTG
ATCGTGTTTC GCTGCTCCTT GCCTCGTTGG CTTCGTCTAT TTCACAATGC GAGATTTGGA ATAAATCAGA GCGGTTAATC
CTGTAAGTTC ATATGTAACG TACCCATTTG ATTTTTTATT GGTTACATAT Ggttactccc tccggtttca ttttaattga
cactttgaac aataatacgt tttacaagat atacctttga cttta