Os01t0645400-01

Locus

Os01g0645400

Description

Flavin monooxygenase-like enzyme , Auxin biosynthesis

RAP-DB Gene Symbol Synonym(s)

YUCCA1, OsYUCCA1, OsYUC1

RAP-DB Gene Name Synonym(s)

YUCCA-LIKE GENE 1, (YUCCA-like gene)

CGSNL Gene Symbol

YUCCA1

CGSNL Gene Name

YUCCA-LIKE GENE 1

Oryzabase Gene Symbol Synonym(s)

OsYUCCA1, OsYUC1, YUC1

Oryzabase Gene Name Synonym(s)

(YUCCA-like gene)

Transcript Evidence

AK105488 (DDBJ)

Protein Evidence

Q5VRB9 (UniProt)

Literature

PMID: 17220367

Note

Manual Curation

June 28, 2010

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: N,N-dimethylaniline monooxygenase activity (GO:0004499)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: flavin adenine dinucleotide binding (GO:0050660)

Molecular Function: NADP binding (GO:0050661)

Functional domain (InterPro)

Pyridine nucleotide-disulphide oxidoreductase, class-II (IPR000103)

FAD-dependent pyridine nucleotide-disulphide oxidoreductase (IPR013027)

NAD(P)-binding domain (IPR016040)

Flavin monooxygenase-like (IPR020946)

Full-length cDNA

001-127-B10 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0645400-01)

Others

Oryzabase (7438)

Transcript

1535 bp

>Os01t0645400-01 Flavin monooxygenase-like enzyme , Auxin biosynthesis
acctagttggcagtaaaaaaagcgccgctacctacacacacaaccgctctgcacaagggg
ccatggacaacaagccggcgcaagaacgccgcgagacgtgggtcccgggcgccgtcatcg
tcggcgcgggcccgtcggggctcgccgcggcggcgtgcctcgcggcgcggggcgttccgg
cgacggtgcttgagcggtccgactcgctggcgtccacgtggcgccaccgcatgtacgacc
gcctcgctctccacctgcccaagcgcttctgcgagctgccgctcctcccgttcccggagg
agtacccgacgtacccgtccaaggaccagttcgtggcgtacatggaggcgtacgccgcgg
cggcgggcgtcgcgccgcgcttcggcgccaccgtcgaggaggccgcgttcgacgcggccg
tcggcgcatggagggtgcgtctcgacggcggggaggtgctcatggcgcggtggctcgtcg
tcgcgacgggggagaacgccgagccgcgggtgccggactttcccggcatgcagaagttcg
ccgggtgtgccatgcatacttccgagtacaagtccggcgagcagtttgccggtaagaagg
tgttggtcgtgggatgcgggaattctggcatggaagtgagcttggatttgtgccggcatg
gcgcgaagccctccatggtggtgcgcaacacggtgcatgtcctaccaagggaaatgttcg
gtctatccacgttcggcatcgccatggcgctgctgcgatggctaccggttcagctcgtcg
accggttccttctcacggcggctcacctcatcctcggtaacacggggcagttcggcctaa
ggcggcccaaaacagggcccatcgagctcaagaacctcaccggcaggacacccgtactgg
acgttgggacgctagaccacatcaaatccggcaaaattaaggtagtgggagcagtgaagg
agatgacgaggcaaggggtcaggttcacggatggcaaggaggagcaattcgacacaataa
tcctcgccacaggctacaggagcaacgtgccatcttggctcaaggtaaagcagagtgtga
ctcactcttgttcgttttatttttctttctgtccgcactgcactatactactactagtga
tatatatctcgagatgatacggattatatggtcaactgtcaagcccaaggatgttaatta
tatgtctatatgtacgtgtgctttatgtgttgtaggatgccggtgacttgttcacgaggg
agggcatttccaaggtccccttccctaacagctggagagggcggaatggtctctacaccg
tcggattcactcagcgggggctcctcggcacgtcatcggacgccctcaacgtcgccaaag
acatacattgccaatggagagaaagggaccgatctgctattaatgtacttgaaataagca
actcttccttttgatttgactggaaatgtacagtgttttgattaggaatattgtattgtg
tgcatataacaccatgttctatctcccttttcaac

CDS

1095 bp

>Os01t0645400-01 Flavin monooxygenase-like enzyme , Auxin biosynthesis
atggacaacaagccggcgcaagaacgccgcgagacgtgggtcccgggcgccgtcatcgtc
ggcgcgggcccgtcggggctcgccgcggcggcgtgcctcgcggcgcggggcgttccggcg
acggtgcttgagcggtccgactcgctggcgtccacgtggcgccaccgcatgtacgaccgc
ctcgctctccacctgcccaagcgcttctgcgagctgccgctcctcccgttcccggaggag
tacccgacgtacccgtccaaggaccagttcgtggcgtacatggaggcgtacgccgcggcg
gcgggcgtcgcgccgcgcttcggcgccaccgtcgaggaggccgcgttcgacgcggccgtc
ggcgcatggagggtgcgtctcgacggcggggaggtgctcatggcgcggtggctcgtcgtc
gcgacgggggagaacgccgagccgcgggtgccggactttcccggcatgcagaagttcgcc
gggtgtgccatgcatacttccgagtacaagtccggcgagcagtttgccggtaagaaggtg
ttggtcgtgggatgcgggaattctggcatggaagtgagcttggatttgtgccggcatggc
gcgaagccctccatggtggtgcgcaacacggtgcatgtcctaccaagggaaatgttcggt
ctatccacgttcggcatcgccatggcgctgctgcgatggctaccggttcagctcgtcgac
cggttccttctcacggcggctcacctcatcctcggtaacacggggcagttcggcctaagg
cggcccaaaacagggcccatcgagctcaagaacctcaccggcaggacacccgtactggac
gttgggacgctagaccacatcaaatccggcaaaattaaggtagtgggagcagtgaaggag
atgacgaggcaaggggtcaggttcacggatggcaaggaggagcaattcgacacaataatc
ctcgccacaggctacaggagcaacgtgccatcttggctcaaggtaaagcagagtgtgact
cactcttgttcgttttatttttctttctgtccgcactgcactatactactactagtgata
tatatctcgagatga

Protein

365 aa

>Os01t0645400-01 Flavin monooxygenase-like enzyme , Auxin biosynthesis
MDNKPAQERRETWVPGAVIVGAGPSGLAAAACLAARGVPATVLERSDSLASTWRHRMYDR
LALHLPKRFCELPLLPFPEEYPTYPSKDQFVAYMEAYAAAAGVAPRFGATVEEAAFDAAV
GAWRVRLDGGEVLMARWLVVATGENAEPRVPDFPGMQKFAGCAMHTSEYKSGEQFAGKKV
LVVGCGNSGMEVSLDLCRHGAKPSMVVRNTVHVLPREMFGLSTFGIAMALLRWLPVQLVD
RFLLTAAHLILGNTGQFGLRRPKTGPIELKNLTGRTPVLDVGTLDHIKSGKIKVVGAVKE
MTRQGVRFTDGKEEQFDTIILATGYRSNVPSWLKVKQSVTHSCSFYFSFCPHCTILLLVI
YISR*

5'UTR

chr01:25994669..25994730 (+ strand) : 62 bp

CDS

chr01:25994731..25995360 (+ strand) : 630 bp

chr01:25995737..25995985 (+ strand) : 249 bp

chr01:25996244..25996459 (+ strand) : 216 bp

3'UTR

chr01:25996460..25996837 (+ strand) : 378 bp

FASTA

>Os01t0645400-01 class=Sequence position=chr01:25994669..25996837 (+ strand)
acctagttgg cagtaaaaaa agcgccgcta cctacacaca caaccgctct gcacaagggg ccatggacaa caagccggcg
caagaacgcc gcgagacgtg ggtcccgggc gccgtcatcg tcggcgcggg cccgtcgggg ctcgccgcgg cggcgtgcct
cgcggcgcgg ggcgttccgg cgacggtgct tgagcggtcc gactcgctgg cgtccacgtg gcgccaccgc atgtacgacc
gcctcgctct ccacctgccc aagcgcttct gcgagctgcc gctcctcccg ttcccggagg agtacccgac gtacccgtcc
aaggaccagt tcgtggcgta catggaggcg tacgccgcgg cggcgggcgt cgcgccgcgc ttcggcgcca ccgtcgagga
ggccgcgttc gacgcggccg tcggcgcatg gagggtgcgt ctcgacggcg gggaggtgct catggcgcgg tggctcgtcg
tcgcgacggg ggagaacgcc gagccgcggg tgccggactt tcccggcatg cagaagttcg ccgggtgtgc catgcatact
tccgagtaca agtccggcga gcagtttgcc ggtaagaagg tgttggtcgt gggatgcggg aattctggca tggaagtgag
cttggatttg tgccggcatg gcgcgaagcc ctccatggtg gtgcgcaaca cggtaagaaa ctagttaaac tgagcttatg
ctttagaacc tatctatcat gctctgtttt tcccctgttt tttttgtctg tatttgattt atctttctgt gtgtcacatc
ttattgtcat tggacatatt attgtcatct taaatccgtt ttcattgtgc atggctgtat tggatcatat tcaggaagga
gaaattagac ctgttaacat cttccattcc acacaacttt atatgtcggg tgtcttgtcc tatcaacagc cgtttctttc
ttccattttg cctccccctg ccctccgata attacgcgtg tcattttcat tacattatta tgatgacggg ttacacaaat
ctaagcgccg tggtgatgtt tcgtccaggt gcatgtccta ccaagggaaa tgttcggtct atccacgttc ggcatcgcca
tggcgctgct gcgatggcta ccggttcagc tcgtcgaccg gttccttctc acggcggctc acctcatcct cggtaacacg
gggcagttcg gcctaaggcg gcccaaaaca gggcccatcg agctcaagaa cctcaccggc aggacacccg tactggacgt
tgggacgcta gaccacatca aatccggcaa aattaaggtt agtgccaacc attcagctag cctagctcct ttcaagaacc
agtagtagaa actgagacca gtcaaactgt cgagctgtac atgtgagctg ctgggcgtct acttcctaat gtggcacatc
agctattcgc acatgcagca tgtacatttc tcttgtggaa aatggttctc atatggagat tcatttattt tatccctgtg
ggttttctcc tgtgctttga ttgatgaggc gctgatggga atcatgcatc actaggtagt gggagcagtg aaggagatga
cgaggcaagg ggtcaggttc acggatggca aggaggagca attcgacaca ataatcctcg ccacaggcta caggagcaac
gtgccatctt ggctcaaggt aaagcagagt gtgactcact cttgttcgtt ttatttttct ttctgtccgc actgcactat
actactacta gtgatatata tctcgagatg atacggatta tatggtcaac tgtcaagccc aaggatgtta attatatgtc
tatatgtacg tgtgctttat gtgttgtagg atgccggtga cttgttcacg agggagggca tttccaaggt ccccttccct
aacagctgga gagggcggaa tggtctctac accgtcggat tcactcagcg ggggctcctc ggcacgtcat cggacgccct
caacgtcgcc aaagacatac attgccaatg gagagaaagg gaccgatctg ctattaatgt acttgaaata agcaactctt
ccttttgatt tgactggaaa tgtacagtgt tttgattagg aatattgtat tgtgtgcata taacaccatg ttctatctcc
cttttcaac

Locus: Os01g0645400

Loading...

Locus: Os01g0645400

Loading...