Os01t0645400-02

Locus

Os01g0645400

Description

Flavin monooxygenase-like enzyme , Auxin biosynthesis

RAP-DB Gene Symbol Synonym(s)

YUCCA1, OsYUCCA1

RAP-DB Gene Name Synonym(s)

YUCCA-LIKE GENE 1, YUCCA-like gene 1

CGSNL Gene Symbol

YUCCA1

CGSNL Gene Name

YUCCA-LIKE GENE 1

Oryzabase Gene Symbol Synonym(s)

OsYUCCA1, OsYUC1, YUC1

Oryzabase Gene Name Synonym(s)

(YUCCA-like gene)

Transcript Evidence

Inferred from literature

Protein Evidence

Inferred from literature

Literature

PMID: 17220367

Note

Manual Curation

June 28, 2010

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: N,N-dimethylaniline monooxygenase activity (GO:0004499)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: flavin adenine dinucleotide binding (GO:0050660)

Molecular Function: NADP binding (GO:0050661)

Functional domain (InterPro)

Pyridine nucleotide-disulphide oxidoreductase, class-II (IPR000103)

FAD-dependent pyridine nucleotide-disulphide oxidoreductase (IPR013027)

Flavin monooxygenase-like (IPR020946)

Expression Databases

TENOR (Os01t0645400-02)

Others

Oryzabase (7438)

Transcript

1221 bp

>Os01t0645400-02 Flavin monooxygenase-like enzyme , Auxin biosynthesis
atggacaacaagccggcgcaagaacgccgcgagacgtgggtcccgggcgccgtcatcgtc
ggcgcgggcccgtcggggctcgccgcggcggcgtgcctcgcggcgcggggcgttccggcg
acggtgcttgagcggtccgactcgctggcgtccacgtggcgccaccgcatgtacgaccgc
ctcgctctccacctgcccaagcgcttctgcgagctgccgctcctcccgttcccggaggag
tacccgacgtacccgtccaaggaccagttcgtggcgtacatggaggcgtacgccgcggcg
gcgggcgtcgcgccgcgcttcggcgccaccgtcgaggaggccgcgttcgacgcggccgtc
ggcgcatggagggtgcgtctcgacggcggggaggtgctcatggcgcggtggctcgtcgtc
gcgacgggggagaacgccgagccgcgggtgccggactttcccggcatgcagaagttcgcc
gggtgtgccatgcatacttccgagtacaagtccggcgagcagtttgccggtaagaaggtg
ttggtcgtgggatgcgggaattctggcatggaagtgagcttggatttgtgccggcatggc
gcgaagccctccatggtggtgcgcaacacggtgcatgtcctaccaagggaaatgttcggt
ctatccacgttcggcatcgccatggcgctgctgcgatggctaccggttcagctcgtcgac
cggttccttctcacggcggctcacctcatcctcggtaacacggggcagttcggcctaagg
cggcccaaaacagggcccatcgagctcaagaacctcaccggcaggacacccgtactggac
gttgggacgctagaccacatcaaatccggcaaaattaaggtagtgggagcagtgaaggag
atgacgaggcaaggggtcaggttcacggatggcaaggaggagcaattcgacacaataatc
ctcgccacaggctacaggagcaacgtgccatcttggctcaaggatgccggtgacttgttc
acgagggagggcatttccaaggtccccttccctaacagctggagagggcggaatggtctc
tacaccgtcggattcactcagcgggggctcctcggcacgtcatcggacgccctcaacgtc
gccaaagacatacattgccaatggagagaaagggaccgatctgctattaatgtacttgaa
ataagcaactcttccttttga

CDS

1221 bp

>Os01t0645400-02 Flavin monooxygenase-like enzyme , Auxin biosynthesis
atggacaacaagccggcgcaagaacgccgcgagacgtgggtcccgggcgccgtcatcgtc
ggcgcgggcccgtcggggctcgccgcggcggcgtgcctcgcggcgcggggcgttccggcg
acggtgcttgagcggtccgactcgctggcgtccacgtggcgccaccgcatgtacgaccgc
ctcgctctccacctgcccaagcgcttctgcgagctgccgctcctcccgttcccggaggag
tacccgacgtacccgtccaaggaccagttcgtggcgtacatggaggcgtacgccgcggcg
gcgggcgtcgcgccgcgcttcggcgccaccgtcgaggaggccgcgttcgacgcggccgtc
ggcgcatggagggtgcgtctcgacggcggggaggtgctcatggcgcggtggctcgtcgtc
gcgacgggggagaacgccgagccgcgggtgccggactttcccggcatgcagaagttcgcc
gggtgtgccatgcatacttccgagtacaagtccggcgagcagtttgccggtaagaaggtg
ttggtcgtgggatgcgggaattctggcatggaagtgagcttggatttgtgccggcatggc
gcgaagccctccatggtggtgcgcaacacggtgcatgtcctaccaagggaaatgttcggt
ctatccacgttcggcatcgccatggcgctgctgcgatggctaccggttcagctcgtcgac
cggttccttctcacggcggctcacctcatcctcggtaacacggggcagttcggcctaagg
cggcccaaaacagggcccatcgagctcaagaacctcaccggcaggacacccgtactggac
gttgggacgctagaccacatcaaatccggcaaaattaaggtagtgggagcagtgaaggag
atgacgaggcaaggggtcaggttcacggatggcaaggaggagcaattcgacacaataatc
ctcgccacaggctacaggagcaacgtgccatcttggctcaaggatgccggtgacttgttc
acgagggagggcatttccaaggtccccttccctaacagctggagagggcggaatggtctc
tacaccgtcggattcactcagcgggggctcctcggcacgtcatcggacgccctcaacgtc
gccaaagacatacattgccaatggagagaaagggaccgatctgctattaatgtacttgaa
ataagcaactcttccttttga

Protein

407 aa

>Os01t0645400-02 Flavin monooxygenase-like enzyme , Auxin biosynthesis
MDNKPAQERRETWVPGAVIVGAGPSGLAAAACLAARGVPATVLERSDSLASTWRHRMYDR
LALHLPKRFCELPLLPFPEEYPTYPSKDQFVAYMEAYAAAAGVAPRFGATVEEAAFDAAV
GAWRVRLDGGEVLMARWLVVATGENAEPRVPDFPGMQKFAGCAMHTSEYKSGEQFAGKKV
LVVGCGNSGMEVSLDLCRHGAKPSMVVRNTVHVLPREMFGLSTFGIAMALLRWLPVQLVD
RFLLTAAHLILGNTGQFGLRRPKTGPIELKNLTGRTPVLDVGTLDHIKSGKIKVVGAVKE
MTRQGVRFTDGKEEQFDTIILATGYRSNVPSWLKDAGDLFTREGISKVPFPNSWRGRNGL
YTVGFTQRGLLGTSSDALNVAKDIHCQWRERDRSAINVLEISNSSF*

CDS

chr01:25994731..25995360 (+ strand) : 630 bp

chr01:25995737..25995985 (+ strand) : 249 bp

chr01:25996244..25996366 (+ strand) : 123 bp

chr01:25996538..25996756 (+ strand) : 219 bp

FASTA

>Os01t0645400-02 class=Sequence position=chr01:25994731..25996756 (+ strand)
atggacaaca agccggcgca agaacgccgc gagacgtggg tcccgggcgc cgtcatcgtc ggcgcgggcc cgtcggggct
cgccgcggcg gcgtgcctcg cggcgcgggg cgttccggcg acggtgcttg agcggtccga ctcgctggcg tccacgtggc
gccaccgcat gtacgaccgc ctcgctctcc acctgcccaa gcgcttctgc gagctgccgc tcctcccgtt cccggaggag
tacccgacgt acccgtccaa ggaccagttc gtggcgtaca tggaggcgta cgccgcggcg gcgggcgtcg cgccgcgctt
cggcgccacc gtcgaggagg ccgcgttcga cgcggccgtc ggcgcatgga gggtgcgtct cgacggcggg gaggtgctca
tggcgcggtg gctcgtcgtc gcgacggggg agaacgccga gccgcgggtg ccggactttc ccggcatgca gaagttcgcc
gggtgtgcca tgcatacttc cgagtacaag tccggcgagc agtttgccgg taagaaggtg ttggtcgtgg gatgcgggaa
ttctggcatg gaagtgagct tggatttgtg ccggcatggc gcgaagccct ccatggtggt gcgcaacacg gtaagaaact
agttaaactg agcttatgct ttagaaccta tctatcatgc tctgtttttc ccctgttttt tttgtctgta tttgatttat
ctttctgtgt gtcacatctt attgtcattg gacatattat tgtcatctta aatccgtttt cattgtgcat ggctgtattg
gatcatattc aggaaggaga aattagacct gttaacatct tccattccac acaactttat atgtcgggtg tcttgtccta
tcaacagccg tttctttctt ccattttgcc tccccctgcc ctccgataat tacgcgtgtc attttcatta cattattatg
atgacgggtt acacaaatct aagcgccgtg gtgatgtttc gtccaggtgc atgtcctacc aagggaaatg ttcggtctat
ccacgttcgg catcgccatg gcgctgctgc gatggctacc ggttcagctc gtcgaccggt tccttctcac ggcggctcac
ctcatcctcg gtaacacggg gcagttcggc ctaaggcggc ccaaaacagg gcccatcgag ctcaagaacc tcaccggcag
gacacccgta ctggacgttg ggacgctaga ccacatcaaa tccggcaaaa ttaaggttag tgccaaccat tcagctagcc
tagctccttt caagaaccag tagtagaaac tgagaccagt caaactgtcg agctgtacat gtgagctgct gggcgtctac
ttcctaatgt ggcacatcag ctattcgcac atgcagcatg tacatttctc ttgtggaaaa tggttctcat atggagattc
atttatttta tccctgtggg ttttctcctg tgctttgatt gatgaggcgc tgatgggaat catgcatcac taggtagtgg
gagcagtgaa ggagatgacg aggcaagggg tcaggttcac ggatggcaag gaggagcaat tcgacacaat aatcctcgcc
acaggctaca ggagcaacgt gccatcttgg ctcaaggtaa agcagagtgt gactcactct tgttcgtttt atttttcttt
ctgtccgcac tgcactatac tactactagt gatatatatc tcgagatgat acggattata tggtcaactg tcaagcccaa
ggatgttaat tatatgtcta tatgtacgtg tgctttatgt gttgtaggat gccggtgact tgttcacgag ggagggcatt
tccaaggtcc ccttccctaa cagctggaga gggcggaatg gtctctacac cgtcggattc actcagcggg ggctcctcgg
cacgtcatcg gacgccctca acgtcgccaa agacatacat tgccaatgga gagaaaggga ccgatctgct attaatgtac
ttgaaataag caactcttcc ttttga

Locus: Os01g0645400

Loading...

Locus: Os01g0645400

Loading...