Os01t0652800-01

Locus

Os01g0652800

Description

Protein of unknown function DUF231, plant domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsTBL57, TBL57

Oryzabase Gene Name Synonym(s)

trichome birefringence-like 57

Transcript Evidence

AK061145 (DDBJ, Best hit)

AK103547 (DDBJ, Best hit)

AK104312 (DDBJ, Best hit)

Protein Evidence

A2WTA8 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Domain of unknown function DUF231, plant (IPR004253)

Full-length cDNA

006-208-D04 (Online Clone Ordering)

J033132E17 (Online Clone Ordering)

001-018-G10 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0652800-01)

RiceXPro (AK061145)

Others

Oryzabase (21511)

KEGG (Os01t0652800-01)

Transcript

1741 bp

>Os01t0652800-01 Protein of unknown function DUF231, plant domain containing protein.
GTAGAAGATACAGCATGCGAGCAAGCAAGAGCGGTTTTAGCCATCAAAGCCGAAAGCCAT
CCGGGCATTCGCTCTCCCCTCGCTGCTAGCTAGCTTTGCTTGCTAATCTAGAGCTAAGCA
CCAAATGGTCCTGATTGTTCTTCTCGCTTCTGAATTGTTGTGACCTGTAACTACAAAGGC
ATAGTTAGGTAGATATAGAAAGAGGGGGGGAGAGGGGCCGGAGGCCGGAGCGGCGGGGGC
GGCGGCGAGATGAAGCTCCACTTCGTGCTCAGGTTCCTGTTCGGCCCCGTGCCGGTGTAC
TTCTCGGCGCTGGCCATCCTCATCCTGCTGACGAACGCGCAGTACTTCGGGCTGGTGGGC
GTCACCGTTCCCCGCGCGACGAAGCTGGCGTCGTCGGCGCCGGTGGTGAGCGTGATGAAG
TACTGCGACATCTTCCGCGGCGAGTGGGTGCCGGACTCCGACGCGCCCTACTACAACCAC
AAGACGTGTTACATGATCCAGGAGCACCAGAACTGCCTCAAGTACGGCCGCCCCGACCTC
GAATTCCTCAAGTGGCGGTGGCGCCCCTCCGGCTGCGAGCTGCCCCGCTTCGACCCCGTG
CAGTTCCTACAGTTCAACCGTCACAAGTCGCTCGCCTTCGTCGGTGACTCGCTGGCTCGC
AACCACATGCAATCCCTGCTCTGCCTCCTCTCCCAGGTGGCGTATCCCAAAGACATGTCG
GCGAACCCGACGACTCAGAACAAGGTGTACCACTACAGGGGGTACAACTTCACCGTCAGC
ATGTTCTGGTCGCCGTTCCTGGTGAAGGCGCGTGAGCCCGACCACGACGGGCCGGCGCAC
ACGGGCCACTGGAGCCTGTACCTCGACGAGCCCGACCAGTCGTGGGTGTCCGAGATCTCG
CGGTTCGACTACGTGCTGGTGTCCGCCGCCAACTGGTTCTCCAGGCCGTCGCTCTTCTAC
GAGAAGCGGCGGCTGGTCGGGTGCAGCTTCTGCAGCAGGCAGTACGGCGTGCCGGACCTG
ACGCTCTACTACTCGCAGCGCCGGGCGTGGCGCGTGGCGCTGAAGGCGATCAACGACCTG
GAGAGCCTCCGCGGGCGGGTGATCGTGCGGATGCTGTCGCCGATGTCGCACTTCGAGAAC
GGGACGTGGGACCAGGGCGGCAACTGCAAGCGGACGCAGCCGCTCCGGAGCAACGAGACG
GTGATGGAGGGGCGGGACCTGCACTTCTACACGGCGCAGATGGAGGAGTACCGCGCCGCG
GAGAAGGTCGCGGAGGCCAAGGGCCGGCGGATGATGCTCATGGACGCCACGGCGGCGATG
CTGATGCGGCCCGACGGCCACCCCAGCCGGTACGGCCACCTGCCGAACCAGAAGGTGCAG
CTCTACAACGACTGCATCCACTGGTGCCTGCCAGGCCCCATCGACATCTGGAACGACATG
CTCTTCCAGATGCTCCTCGTCTAACGCGATCGATCGCCAATTCGCCATCGGTAAATGCGA
CTTCTACTGCACAGACAGGATTGCTCTTGCTGTTGTTTCAAAGCAGTTTTGACAAGGATT
TATTCGAACTTCCCCAATAGATTCTTTTTTTCTCTCTCTTTTCCCTTCATTTCCTTTCAT
TTTTCGTTTATGCTGACGCGAATTTTTAATGGATCGTCACCGGAAAGAGTGAACGAAAGT
GTGCCTCCGAAAGACCACTGTGATACTGTCACTCCATTCATTTCCAATACTTGAAACCAA
C

CDS

1215 bp

>Os01t0652800-01 Protein of unknown function DUF231, plant domain containing protein.
ATGAAGCTCCACTTCGTGCTCAGGTTCCTGTTCGGCCCCGTGCCGGTGTACTTCTCGGCG
CTGGCCATCCTCATCCTGCTGACGAACGCGCAGTACTTCGGGCTGGTGGGCGTCACCGTT
CCCCGCGCGACGAAGCTGGCGTCGTCGGCGCCGGTGGTGAGCGTGATGAAGTACTGCGAC
ATCTTCCGCGGCGAGTGGGTGCCGGACTCCGACGCGCCCTACTACAACCACAAGACGTGT
TACATGATCCAGGAGCACCAGAACTGCCTCAAGTACGGCCGCCCCGACCTCGAATTCCTC
AAGTGGCGGTGGCGCCCCTCCGGCTGCGAGCTGCCCCGCTTCGACCCCGTGCAGTTCCTA
CAGTTCAACCGTCACAAGTCGCTCGCCTTCGTCGGTGACTCGCTGGCTCGCAACCACATG
CAATCCCTGCTCTGCCTCCTCTCCCAGGTGGCGTATCCCAAAGACATGTCGGCGAACCCG
ACGACTCAGAACAAGGTGTACCACTACAGGGGGTACAACTTCACCGTCAGCATGTTCTGG
TCGCCGTTCCTGGTGAAGGCGCGTGAGCCCGACCACGACGGGCCGGCGCACACGGGCCAC
TGGAGCCTGTACCTCGACGAGCCCGACCAGTCGTGGGTGTCCGAGATCTCGCGGTTCGAC
TACGTGCTGGTGTCCGCCGCCAACTGGTTCTCCAGGCCGTCGCTCTTCTACGAGAAGCGG
CGGCTGGTCGGGTGCAGCTTCTGCAGCAGGCAGTACGGCGTGCCGGACCTGACGCTCTAC
TACTCGCAGCGCCGGGCGTGGCGCGTGGCGCTGAAGGCGATCAACGACCTGGAGAGCCTC
CGCGGGCGGGTGATCGTGCGGATGCTGTCGCCGATGTCGCACTTCGAGAACGGGACGTGG
GACCAGGGCGGCAACTGCAAGCGGACGCAGCCGCTCCGGAGCAACGAGACGGTGATGGAG
GGGCGGGACCTGCACTTCTACACGGCGCAGATGGAGGAGTACCGCGCCGCGGAGAAGGTC
GCGGAGGCCAAGGGCCGGCGGATGATGCTCATGGACGCCACGGCGGCGATGCTGATGCGG
CCCGACGGCCACCCCAGCCGGTACGGCCACCTGCCGAACCAGAAGGTGCAGCTCTACAAC
GACTGCATCCACTGGTGCCTGCCAGGCCCCATCGACATCTGGAACGACATGCTCTTCCAG
ATGCTCCTCGTCTAA

Protein

405 aa

>Os01t0652800-01 Protein of unknown function DUF231, plant domain containing protein.
MKLHFVLRFLFGPVPVYFSALAILILLTNAQYFGLVGVTVPRATKLASSAPVVSVMKYCD
IFRGEWVPDSDAPYYNHKTCYMIQEHQNCLKYGRPDLEFLKWRWRPSGCELPRFDPVQFL
QFNRHKSLAFVGDSLARNHMQSLLCLLSQVAYPKDMSANPTTQNKVYHYRGYNFTVSMFW
SPFLVKAREPDHDGPAHTGHWSLYLDEPDQSWVSEISRFDYVLVSAANWFSRPSLFYEKR
RLVGCSFCSRQYGVPDLTLYYSQRRAWRVALKAINDLESLRGRVIVRMLSPMSHFENGTW
DQGGNCKRTQPLRSNETVMEGRDLHFYTAQMEEYRAAEKVAEAKGRRMMLMDATAAMLMR
PDGHPSRYGHLPNQKVQLYNDCIHWCLPGPIDIWNDMLFQMLLV*

5'UTR

chr01:26403229..26403477 (- strand) : 249 bp

CDS

chr01:26402782..26403228 (- strand) : 447 bp

chr01:26401846..26402613 (- strand) : 768 bp

3'UTR

chr01:26401569..26401845 (- strand) : 277 bp

FASTA

>Os01t0652800-01 class=Sequence position=chr01:26401569..26403477 (- strand)
GTAGAAGATA CAGCATGCGA GCAAGCAAGA GCGGTTTTAG CCATCAAAGC CGAAAGCCAT CCGGGCATTC GCTCTCCCCT
CGCTGCTAGC TAGCTTTGCT TGCTAATCTA GAGCTAAGCA CCAAATGGTC CTGATTGTTC TTCTCGCTTC TGAATTGTTG
TGACCTGTAA CTACAAAGGC ATAGTTAGGT AGATATAGAA AGAGGGGGGG AGAGGGGCCG GAGGCCGGAG CGGCGGGGGC
GGCGGCGAGA TGAAGCTCCA CTTCGTGCTC AGGTTCCTGT TCGGCCCCGT GCCGGTGTAC TTCTCGGCGC TGGCCATCCT
CATCCTGCTG ACGAACGCGC AGTACTTCGG GCTGGTGGGC GTCACCGTTC CCCGCGCGAC GAAGCTGGCG TCGTCGGCGC
CGGTGGTGAG CGTGATGAAG TACTGCGACA TCTTCCGCGG CGAGTGGGTG CCGGACTCCG ACGCGCCCTA CTACAACCAC
AAGACGTGTT ACATGATCCA GGAGCACCAG AACTGCCTCA AGTACGGCCG CCCCGACCTC GAATTCCTCA AGTGGCGGTG
GCGCCCCTCC GGCTGCGAGC TGCCCCGCTT CGACCCCGTG CAGTTCCTAC AGTTCAACCG TCACAAGTCG CTCGCCTTCG
TCGGTGACTC GCTGGCTCGC AACCACATGC AATCCCTGCT CTGCCTCCTC TCCCAGGTAA GAGTGCTTGC TTTCACAGGC
TTTTCAGTCT GCCAAGTTCA ATTCTTTGGG GGGTGTGTGT GTGTGGTGAC AACGTGAGAC GTTGCCATGT TTGCACAATG
GCCTGAGACG GCGAGAAGCT GACCCGATGG TTTTCCTTTC CTCTCTGGGA CGGGGCAACT GTAGGTGGCG TATCCCAAAG
ACATGTCGGC GAACCCGACG ACTCAGAACA AGGTGTACCA CTACAGGGGG TACAACTTCA CCGTCAGCAT GTTCTGGTCG
CCGTTCCTGG TGAAGGCGCG TGAGCCCGAC CACGACGGGC CGGCGCACAC GGGCCACTGG AGCCTGTACC TCGACGAGCC
CGACCAGTCG TGGGTGTCCG AGATCTCGCG GTTCGACTAC GTGCTGGTGT CCGCCGCCAA CTGGTTCTCC AGGCCGTCGC
TCTTCTACGA GAAGCGGCGG CTGGTCGGGT GCAGCTTCTG CAGCAGGCAG TACGGCGTGC CGGACCTGAC GCTCTACTAC
TCGCAGCGCC GGGCGTGGCG CGTGGCGCTG AAGGCGATCA ACGACCTGGA GAGCCTCCGC GGGCGGGTGA TCGTGCGGAT
GCTGTCGCCG ATGTCGCACT TCGAGAACGG GACGTGGGAC CAGGGCGGCA ACTGCAAGCG GACGCAGCCG CTCCGGAGCA
ACGAGACGGT GATGGAGGGG CGGGACCTGC ACTTCTACAC GGCGCAGATG GAGGAGTACC GCGCCGCGGA GAAGGTCGCG
GAGGCCAAGG GCCGGCGGAT GATGCTCATG GACGCCACGG CGGCGATGCT GATGCGGCCC GACGGCCACC CCAGCCGGTA
CGGCCACCTG CCGAACCAGA AGGTGCAGCT CTACAACGAC TGCATCCACT GGTGCCTGCC AGGCCCCATC GACATCTGGA
ACGACATGCT CTTCCAGATG CTCCTCGTCT AACGCGATCG ATCGCCAATT CGCCATCGGT AAATGCGACT TCTACTGCAC
AGACAGGATT GCTCTTGCTG TTGTTTCAAA GCAGTTTTGA CAAGGATTTA TTCGAACTTC CCCAATAGAT TCTTTTTTTC
TCTCTCTTTT CCCTTCATTT CCTTTCATTT TTCGTTTATG CTGACGCGAA TTTTTAATGG ATCGTCACCG GAAAGAGTGA
ACGAAAGTGT GCCTCCGAAA GACCACTGTG ATACTGTCAC TCCATTCATT TCCAATACTT GAAACCAAC

Locus: Os01g0652800

Loading...

Locus: Os01g0652800

Loading...