Os01t0652800-04

Locus

Os01g0652800

Description

Domain of unknown function DUF231, plant domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsTBL57, TBL57

Oryzabase Gene Name Synonym(s)

trichome birefringence-like 57

Transcript Evidence

AK058693 (DDBJ, Best hit)

Protein Evidence

Q5VPB1 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Domain of unknown function DUF231, plant (IPR004253)

Full-length cDNA

001-019-B06 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0652800-04)

RiceXPro (AK058693)

Others

Oryzabase (21511)

KEGG (Os01t0652800-04)

Transcript

316 bp

>Os01t0652800-04 Domain of unknown function DUF231, plant domain containing protein.
GATGCTCATGGACGCCACGGCGGCGATGCTGATGCGGCCCGACGGCCACCCCAGCCGGTA
CGGCCACCTGCCGAACCAGAAGGTGCAGCTCTACAACGACTGCATCCACTGGTGCCTGCC
AGGCCCCATCGACATCTGGAACGACATGCTCTTCCAGATGCTCCTCGTCTAACGCGATCG
ATCGCCAATTCGCCATCGGTAAATGCGACTTCTACTGCACAGACAGGATTGCTCTTGCTG
TTGTTTCAAAGCAGTTTTGACAAGGATTTATTCGAACTTCCCCAATAGATTCTTTTTTTC
TCTCTCTTTTCCCTTC

CDS

171 bp

>Os01t0652800-04 Domain of unknown function DUF231, plant domain containing protein.
ATGCTCATGGACGCCACGGCGGCGATGCTGATGCGGCCCGACGGCCACCCCAGCCGGTAC
GGCCACCTGCCGAACCAGAAGGTGCAGCTCTACAACGACTGCATCCACTGGTGCCTGCCA
GGCCCCATCGACATCTGGAACGACATGCTCTTCCAGATGCTCCTCGTCTAA

Protein

57 aa

>Os01t0652800-04 Domain of unknown function DUF231, plant domain containing protein.
MLMDATAAMLMRPDGHPSRYGHLPNQKVQLYNDCIHWCLPGPIDIWNDMLFQMLLV*

5'UTR

chr01:26402017..26402017 (- strand) : 1 bp

CDS

chr01:26401846..26402016 (- strand) : 171 bp

3'UTR

chr01:26401702..26401845 (- strand) : 144 bp

FASTA

>Os01t0652800-04 class=Sequence position=chr01:26401702..26402017 (- strand)
GATGCTCATG GACGCCACGG CGGCGATGCT GATGCGGCCC GACGGCCACC CCAGCCGGTA CGGCCACCTG CCGAACCAGA
AGGTGCAGCT CTACAACGAC TGCATCCACT GGTGCCTGCC AGGCCCCATC GACATCTGGA ACGACATGCT CTTCCAGATG
CTCCTCGTCT AACGCGATCG ATCGCCAATT CGCCATCGGT AAATGCGACT TCTACTGCAC AGACAGGATT GCTCTTGCTG
TTGTTTCAAA GCAGTTTTGA CAAGGATTTA TTCGAACTTC CCCAATAGAT TCTTTTTTTC TCTCTCTTTT CCCTTC

Locus: Os01g0652800

Loading...

Locus: Os01g0652800

Loading...