Os01t0655300-01

Locus

Os01g0655300

Description

TRITHORAX-like protein, Regulation of H3K4 methylation, Regulation of plant height and pollen grain development

RAP-DB Gene Symbol Synonym(s)

SDG705

RAP-DB Gene Name Synonym(s)

SET-domain group protein 705

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET2, SDG705

Oryzabase Gene Name Synonym(s)

SET protein 2

Transcript Evidence

AK062870 (truncated)

Protein Evidence

B9EYE3

Literature

PMID: 29473711

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

April 14, 2020

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Zinc finger, FYVE/PHD-type (IPR011011)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Histone-lysine N-methyltransferase ATX (IPR025780)

PWWP domain (IPR000313)

Zinc finger, PHD-type (IPR001965)

Zinc finger, PHD-finger (IPR019787)

Extended PHD (ePHD) domain (IPR034732)

ATX3/4/5, PHD domain (IPR042011)

SET domain (IPR001214)

Post-SET domain (IPR003616)

Zinc finger, PHD-type, conserved site (IPR019786)

Full-length cDNA

001-108-C05(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os01t0655300-01)

RiceXPro (AK062870)

Others

Oryzabase (13371)

KEGG (Os01t0655300-01)

Transcript

3334 bp

>Os01t0655300-01 TRITHORAX-like protein, Regulation of H3K4 methylation, Regulation of plant height and pollen grain development
ATGATCTTTAAGCGGAACCAGCGGTCGGAGATCCTCTCGCTGAGGCGGTGCAATGCCGGG
GGCGGCGCCGGGGTCGGGGAGGACGATGGGGACGGCGGCGAGCGGCGGCCCAAGAGGCGG
AGGGGCGACGAGTTCTTCCCCGTGGAGCTGCTCGGCGACGTGCCGGTCGCCGGCATCCCC
TACGCCGCCTTCgggttccgctggtgcgaggaggccgaggtcgcgtccccggccgctgcc
tcgcgggcagcagccgccgccgcggcggcgtctcgaccgccggtggtgcgcacgtcgcgc
gggAGGGCCCAGGTGCTGCCCTCGCGGTTCAACGACTCGGTGCTCATCGACCCCTGGAAG
AAGGATAAGCCGGCGAAGCCACCTGTTCCGGCCAAGGCTGTGCAGCTAGTGCCCAAAAGC
GAGGTGTTATATCGCAAAGGTGCAATTGCTGATAGGAGTCTAACAATGTCAGAGTTAGAT
GAAAATGGCGATGATGATTATGAGGAAGGCCACAACTTTGTTGCCTCCAGGAAGTACTCC
ATGTCCCTCAGCACGGTCACTTCTGTACACGGTGAACCATACAGCTATTACCATAGAAAG
GGACTGATGAAAAGGCAATACGATGACGATGACGATGACGATGACGATGACGATGACGAT
GACGATGACGAGGACGAGGAGGCGGAGGAGGAAGAAGAAGAGGAGGAGGAGGAGGAGGAA
GAGCTATCTTACTGGAGGAATGATTTTGTGTATGGCGACATTGTGTGGGCAAGGCTCGGG
AAGCGGCAGCCGGTGTGGCCGGGGGTGGTGGTCGATCCAGCACAGCCAGCTGCTGCCCAG
GCATTGCCACCACAGCCACGCAGCGGTGCTGTGCTTTGTGTGATGCTGTTCGGCTGGGCT
GCAGAATTCGGTGATGAGAAGAAGTTCATCTGGGTGAGGCAAGGAGGGATATTTCCATTT
GTGGACTACATGGACCGATTTCAAGGGCAGACAGAACTAAGCAGTTGCAAACCTGGTGAT
TTCCAGAGGGCATTAGAAGAGGCATTTTTGGCTGATCAGGGATTCTTCGAAGTTCCAATG
GATGGCAACACAACAGGACAGCCTGCACGTTACAAAAGAGCACTTCAATGTGAGAGTTGT
GGAAATTGCTTTCCAAATAAAGACCCAAGCATGATGGTGTATGTAATGGAACAACTTGCT
TGCAGACAGTGTGCTAAGATACTGCGGTCCAAAGAGTATTGTGGTGTATGTTTGAAAAGC
TGGCAACATAAATGTGGAGGAAGATGGGTTTGTTGTCATGGCTGTGAAAGTTGGGTTCAT
GCAGAATGTGACAAAAAGTGCAGCAACCTCAAGGATCTACGAGACAACAGTTATTTCTGC
CCTTATTGTAGAGTTAAACAGAACTCAAATCTGTCCAGCAAGAAGACAAAATCTTATGAA
CATAGAACTGACAATTCCACACAGAAAAGTAGCAAGCCTGACAAAGTTGCAGTTATCTGT
TTTGGCATGGAAGGAACTTACCTACGAGATCTTGAACTAATTTCTTGCCATTGTGGTCCA
TGCAAGGGACAAAAATTTTTGTTCAATGAATGGGAACGGCATGCTGGCTGCAGAAGTAAA
AACTGGAAGTCAAGTATTAAAATCAAGGACACGCTTATGCCGTTTGGAAAATGGATAGAG
CAACATCAATCAAGTTCATATTCCACAAATCCTGCAAAGCGCTCCTCTCAGAAAATGAAG
AAACAAAAGCTTCTTGATTTGCTAAGTGAACCATATGATACTGTAAATGTAAAATGGACA
ACAGAAAGATGTGCAGTCTGTAGATGGGTTGAAGACTGGGATTACAACAAAATTGTAATC
TGTAACAGATGCCAGATAGCAGTTCATCAGGAATGCTATGGCGTGAGGGGAAAGCAAGAC
TTCACCTCATGGGTTTGTAGGGCTTGTGAAACACCTGATCAAAAAAGGGAGTGTTGTCTT
TGCCCTGTAAAAGGTGGTGCACTGAAGCCAACAAATGTTGATAACTTGTGGGTACATGTG
ACATGTGCATGGTTTCAGCCACAAGTTGCTTTTGCTAGTGATGAGCTGATGGAACCTGCT
ATTGGGATATTGAATATTACGCCTTTGCTATTCATGAAGATGTGTGTCATTTGTAGGCAA
ATACATGGTTCGTGTACACAGTGCTACAGGTGCTCAACTTATTACCATGCCATCTGTGCA
TCAAGGGCAGGCTATAGGATGGAGATACGCTGCTTGGAAAAAAACGGCAAACAGACAACA
AACAAGATTTCATATTGTGCTCATCATCGGGCCCCTAATCCTGACAATGTTTTGATAATT
CAAACTCCTGCTGGAACTATCTCTTCAAAAAAACTTGTTCAGAGCAATGGCACTGTAGCT
GCTTCAAGGCTGATTAGGAAAGATCTTCCCAAGGATTCAGTGTCAGAAGTTGAAATTTCA
GAGAACTTATCTGCAGCAAGATGTCGGTTTTATGTTAAGAAAGAACTAAAGAGATCTCGG
GAGGGAGCAATTGCACACCGTGTAAGGGGATCCTGTCAACATCGATGGGATGAAATCGAC
AGTTTGAATCCACCTAGGGAAGAGAGGGATCCAGAGTCCTTTTCTACTTTTAAGGAGCGT
CTACACTATCTGCAGAAAACAGAGCATACCAGAGTATGCTTTGGTAGGTCAGGAATTCAT
AGATGGGGACTTTTTGCTCGTAGGGGCATTCAAGAAGGAGAAATGGTGCTCGAGTATAGA
GGTGAGCAGGTCAGACGAAGTGTTGCTGATTTAAGGGAAGAACAATATCGTGTACAAGGC
AAAGATTGTTATCTTTTCAAAATCAGCGAGGAAGTAGTCGTTGATGCCACAGATAAAGGA
AACGTGGCACGCTTGATTAATCATTCTTGCACTCCAAACTGCTATGCAAGGATTATGAGT
GTGGGGCATGACGAGAGCCGTATTGTCCTAATCGCCAAGAAAAATGTCTCTGCCGGCGAA
GAGCTAACGTATGACTACTTATTTGACCCTGACGAGGCTGATGATCGCAAAGTTCCTTGC
CTCTGCCAAACGGCTAATTGTCGTAAATTCATGAATTAGTTTACTGTAGATGTCAAATTG
GCCATTAGTTTACTGTTCTTTCTTTCTTTCTTTCTTTTTTCTGGGTTGGCTGGTGGTATA
TGCTTTACCTTGTTCTTTGTTGCTTCCCCATTCTTTAACATAGCATTTAGAAAATAAGTT
TAGCTATAGCTCAGAAGCGCGAGCTTCCATCCCTGTAAATGGCACTAATTTATCGATTAC
AGTCGTTCTTTTCTAATGCAAAAAATTTTGCCCC

CDS

3099 bp

>Os01t0655300-01 TRITHORAX-like protein, Regulation of H3K4 methylation, Regulation of plant height and pollen grain development
ATGATCTTTAAGCGGAACCAGCGGTCGGAGATCCTCTCGCTGAGGCGGTGCAATGCCGGG
GGCGGCGCCGGGGTCGGGGAGGACGATGGGGACGGCGGCGAGCGGCGGCCCAAGAGGCGG
AGGGGCGACGAGTTCTTCCCCGTGGAGCTGCTCGGCGACGTGCCGGTCGCCGGCATCCCC
TACGCCGCCTTCgggttccgctggtgcgaggaggccgaggtcgcgtccccggccgctgcc
tcgcgggcagcagccgccgccgcggcggcgtctcgaccgccggtggtgcgcacgtcgcgc
gggAGGGCCCAGGTGCTGCCCTCGCGGTTCAACGACTCGGTGCTCATCGACCCCTGGAAG
AAGGATAAGCCGGCGAAGCCACCTGTTCCGGCCAAGGCTGTGCAGCTAGTGCCCAAAAGC
GAGGTGTTATATCGCAAAGGTGCAATTGCTGATAGGAGTCTAACAATGTCAGAGTTAGAT
GAAAATGGCGATGATGATTATGAGGAAGGCCACAACTTTGTTGCCTCCAGGAAGTACTCC
ATGTCCCTCAGCACGGTCACTTCTGTACACGGTGAACCATACAGCTATTACCATAGAAAG
GGACTGATGAAAAGGCAATACGATGACGATGACGATGACGATGACGATGACGATGACGAT
GACGATGACGAGGACGAGGAGGCGGAGGAGGAAGAAGAAGAGGAGGAGGAGGAGGAGGAA
GAGCTATCTTACTGGAGGAATGATTTTGTGTATGGCGACATTGTGTGGGCAAGGCTCGGG
AAGCGGCAGCCGGTGTGGCCGGGGGTGGTGGTCGATCCAGCACAGCCAGCTGCTGCCCAG
GCATTGCCACCACAGCCACGCAGCGGTGCTGTGCTTTGTGTGATGCTGTTCGGCTGGGCT
GCAGAATTCGGTGATGAGAAGAAGTTCATCTGGGTGAGGCAAGGAGGGATATTTCCATTT
GTGGACTACATGGACCGATTTCAAGGGCAGACAGAACTAAGCAGTTGCAAACCTGGTGAT
TTCCAGAGGGCATTAGAAGAGGCATTTTTGGCTGATCAGGGATTCTTCGAAGTTCCAATG
GATGGCAACACAACAGGACAGCCTGCACGTTACAAAAGAGCACTTCAATGTGAGAGTTGT
GGAAATTGCTTTCCAAATAAAGACCCAAGCATGATGGTGTATGTAATGGAACAACTTGCT
TGCAGACAGTGTGCTAAGATACTGCGGTCCAAAGAGTATTGTGGTGTATGTTTGAAAAGC
TGGCAACATAAATGTGGAGGAAGATGGGTTTGTTGTCATGGCTGTGAAAGTTGGGTTCAT
GCAGAATGTGACAAAAAGTGCAGCAACCTCAAGGATCTACGAGACAACAGTTATTTCTGC
CCTTATTGTAGAGTTAAACAGAACTCAAATCTGTCCAGCAAGAAGACAAAATCTTATGAA
CATAGAACTGACAATTCCACACAGAAAAGTAGCAAGCCTGACAAAGTTGCAGTTATCTGT
TTTGGCATGGAAGGAACTTACCTACGAGATCTTGAACTAATTTCTTGCCATTGTGGTCCA
TGCAAGGGACAAAAATTTTTGTTCAATGAATGGGAACGGCATGCTGGCTGCAGAAGTAAA
AACTGGAAGTCAAGTATTAAAATCAAGGACACGCTTATGCCGTTTGGAAAATGGATAGAG
CAACATCAATCAAGTTCATATTCCACAAATCCTGCAAAGCGCTCCTCTCAGAAAATGAAG
AAACAAAAGCTTCTTGATTTGCTAAGTGAACCATATGATACTGTAAATGTAAAATGGACA
ACAGAAAGATGTGCAGTCTGTAGATGGGTTGAAGACTGGGATTACAACAAAATTGTAATC
TGTAACAGATGCCAGATAGCAGTTCATCAGGAATGCTATGGCGTGAGGGGAAAGCAAGAC
TTCACCTCATGGGTTTGTAGGGCTTGTGAAACACCTGATCAAAAAAGGGAGTGTTGTCTT
TGCCCTGTAAAAGGTGGTGCACTGAAGCCAACAAATGTTGATAACTTGTGGGTACATGTG
ACATGTGCATGGTTTCAGCCACAAGTTGCTTTTGCTAGTGATGAGCTGATGGAACCTGCT
ATTGGGATATTGAATATTACGCCTTTGCTATTCATGAAGATGTGTGTCATTTGTAGGCAA
ATACATGGTTCGTGTACACAGTGCTACAGGTGCTCAACTTATTACCATGCCATCTGTGCA
TCAAGGGCAGGCTATAGGATGGAGATACGCTGCTTGGAAAAAAACGGCAAACAGACAACA
AACAAGATTTCATATTGTGCTCATCATCGGGCCCCTAATCCTGACAATGTTTTGATAATT
CAAACTCCTGCTGGAACTATCTCTTCAAAAAAACTTGTTCAGAGCAATGGCACTGTAGCT
GCTTCAAGGCTGATTAGGAAAGATCTTCCCAAGGATTCAGTGTCAGAAGTTGAAATTTCA
GAGAACTTATCTGCAGCAAGATGTCGGTTTTATGTTAAGAAAGAACTAAAGAGATCTCGG
GAGGGAGCAATTGCACACCGTGTAAGGGGATCCTGTCAACATCGATGGGATGAAATCGAC
AGTTTGAATCCACCTAGGGAAGAGAGGGATCCAGAGTCCTTTTCTACTTTTAAGGAGCGT
CTACACTATCTGCAGAAAACAGAGCATACCAGAGTATGCTTTGGTAGGTCAGGAATTCAT
AGATGGGGACTTTTTGCTCGTAGGGGCATTCAAGAAGGAGAAATGGTGCTCGAGTATAGA
GGTGAGCAGGTCAGACGAAGTGTTGCTGATTTAAGGGAAGAACAATATCGTGTACAAGGC
AAAGATTGTTATCTTTTCAAAATCAGCGAGGAAGTAGTCGTTGATGCCACAGATAAAGGA
AACGTGGCACGCTTGATTAATCATTCTTGCACTCCAAACTGCTATGCAAGGATTATGAGT
GTGGGGCATGACGAGAGCCGTATTGTCCTAATCGCCAAGAAAAATGTCTCTGCCGGCGAA
GAGCTAACGTATGACTACTTATTTGACCCTGACGAGGCTGATGATCGCAAAGTTCCTTGC
CTCTGCCAAACGGCTAATTGTCGTAAATTCATGAATTAG

Protein

1033 aa

>Os01t0655300-01 TRITHORAX-like protein, Regulation of H3K4 methylation, Regulation of plant height and pollen grain development
MIFKRNQRSEILSLRRCNAGGGAGVGEDDGDGGERRPKRRRGDEFFPVELLGDVPVAGIP
YAAFGFRWCEEAEVASPAAASRAAAAAAAASRPPVVRTSRGRAQVLPSRFNDSVLIDPWK
KDKPAKPPVPAKAVQLVPKSEVLYRKGAIADRSLTMSELDENGDDDYEEGHNFVASRKYS
MSLSTVTSVHGEPYSYYHRKGLMKRQYDDDDDDDDDDDDDDDDEDEEAEEEEEEEEEEEE
ELSYWRNDFVYGDIVWARLGKRQPVWPGVVVDPAQPAAAQALPPQPRSGAVLCVMLFGWA
AEFGDEKKFIWVRQGGIFPFVDYMDRFQGQTELSSCKPGDFQRALEEAFLADQGFFEVPM
DGNTTGQPARYKRALQCESCGNCFPNKDPSMMVYVMEQLACRQCAKILRSKEYCGVCLKS
WQHKCGGRWVCCHGCESWVHAECDKKCSNLKDLRDNSYFCPYCRVKQNSNLSSKKTKSYE
HRTDNSTQKSSKPDKVAVICFGMEGTYLRDLELISCHCGPCKGQKFLFNEWERHAGCRSK
NWKSSIKIKDTLMPFGKWIEQHQSSSYSTNPAKRSSQKMKKQKLLDLLSEPYDTVNVKWT
TERCAVCRWVEDWDYNKIVICNRCQIAVHQECYGVRGKQDFTSWVCRACETPDQKRECCL
CPVKGGALKPTNVDNLWVHVTCAWFQPQVAFASDELMEPAIGILNITPLLFMKMCVICRQ
IHGSCTQCYRCSTYYHAICASRAGYRMEIRCLEKNGKQTTNKISYCAHHRAPNPDNVLII
QTPAGTISSKKLVQSNGTVAASRLIRKDLPKDSVSEVEISENLSAARCRFYVKKELKRSR
EGAIAHRVRGSCQHRWDEIDSLNPPREERDPESFSTFKERLHYLQKTEHTRVCFGRSGIH
RWGLFARRGIQEGEMVLEYRGEQVRRSVADLREEQYRVQGKDCYLFKISEEVVVDATDKG
NVARLINHSCTPNCYARIMSVGHDESRIVLIAKKNVSAGEELTYDYLFDPDEADDRKVPC
LCQTANCRKFMN*

CDS

chr01:26592223..26593143 (+ strand) : 921 bp

chr01:26593243..26593298 (+ strand) : 56 bp

chr01:26593489..26593618 (+ strand) : 130 bp

chr01:26594138..26594248 (+ strand) : 111 bp

chr01:26594348..26594416 (+ strand) : 69 bp

chr01:26594502..26594567 (+ strand) : 66 bp

chr01:26594656..26594747 (+ strand) : 92 bp

chr01:26594848..26594940 (+ strand) : 93 bp

chr01:26595188..26595323 (+ strand) : 136 bp

chr01:26595444..26595537 (+ strand) : 94 bp

chr01:26595643..26595742 (+ strand) : 100 bp

chr01:26595842..26595966 (+ strand) : 125 bp

chr01:26596339..26596484 (+ strand) : 146 bp

chr01:26596610..26596714 (+ strand) : 105 bp

chr01:26596844..26596908 (+ strand) : 65 bp

chr01:26597113..26597314 (+ strand) : 202 bp

chr01:26597815..26597901 (+ strand) : 87 bp

chr01:26597980..26598036 (+ strand) : 57 bp

chr01:26598111..26598200 (+ strand) : 90 bp

chr01:26598314..26598400 (+ strand) : 87 bp

chr01:26598946..26599020 (+ strand) : 75 bp

chr01:26599105..26599205 (+ strand) : 101 bp

chr01:26599307..26599397 (+ strand) : 91 bp

3'UTR

chr01:26599398..26599632 (+ strand) : 235 bp

FASTA

>Os01t0655300-01 class=Sequence position=chr01:26592223..26599632 (+ strand)
ATGATCTTTA AGCGGAACCA GCGGTCGGAG ATCCTCTCGC TGAGGCGGTG CAATGCCGGG GGCGGCGCCG GGGTCGGGGA
GGACGATGGG GACGGCGGCG AGCGGCGGCC CAAGAGGCGG AGGGGCGACG AGTTCTTCCC CGTGGAGCTG CTCGGCGACG
TGCCGGTCGC CGGCATCCCC TACGCCGCCT TCgggttccg ctggtgcgag gaggccgagg tcgcgtcccc ggccgctgcc
tcgcgggcag cagccgccgc cgcggcggcg tctcgaccgc cggtggtgcg cacgtcgcgc gggAGGGCCC AGGTGCTGCC
CTCGCGGTTC AACGACTCGG TGCTCATCGA CCCCTGGAAG AAGGATAAGC CGGCGAAGCC ACCTGTTCCG GCCAAGGCTG
TGCAGCTAGT GCCCAAAAGC GAGGTGTTAT ATCGCAAAGG TGCAATTGCT GATAGGAGTC TAACAATGTC AGAGTTAGAT
GAAAATGGCG ATGATGATTA TGAGGAAGGC CACAACTTTG TTGCCTCCAG GAAGTACTCC ATGTCCCTCA GCACGGTCAC
TTCTGTACAC GGTGAACCAT ACAGCTATTA CCATAGAAAG GGACTGATGA AAAGGCAATA CGATGACGAT GACGATGACG
ATGACGATGA CGATGACGAT GACGATGACG AGGACGAGGA GGCGGAGGAG GAAGAAGAAG AGGAGGAGGA GGAGGAGGAA
GAGCTATCTT ACTGGAGGAA TGATTTTGTG TATGGCGACA TTGTGTGGGC AAGGCTCGGG AAGCGGCAGC CGGTGTGGCC
GGGGGTGGTG GTCGATCCAG CACAGCCAGC TGCTGCCCAG GCATTGCCAC CACAGCCACG CAGCGGTGCT GTGCTTTGTG
TGATGCTGTT CGGCTGGGCT GCAGAATTCG GTGATGAGAA GGTACATATA ATGACTATTA TGTTCTGGTT TGAATTGGCG
CCTATTTTCT CTGTTAAGAG GTTATTCTGA ATAATGATTT GACAATATGG CGGGTTGCAG AAGTTCATCT GGGTGAGGCA
AGGAGGGATA TTTCCATTTG TGGACTACAT GGACCGGTAA GTAATAATTA CTTATACGAT TGGCATGAAT TATGCCTATA
ACAAATATAG TGTTTCTTGA AAAGTAAAAA CATTTTAGGA AAGGCATTTT TAGTGGTAAA AATGGGAGTA AATGTGTGGT
ACGGCAGATA GTGCCTCTGC GTGTGTACTA ATAAATAGCA TATTTCCATT TCATATCCTG TTTCAGATTT CAAGGGCAGA
CAGAACTAAG CAGTTGCAAA CCTGGTGATT TCCAGAGGGC ATTAGAAGAG GCATTTTTGG CTGATCAGGG ATTCTTCGAA
GTTCCAATGG ATGGCAACAC AACAGGACAG CCTGCAGTGT GCCAATCTTT TCCAGCTGAT TTAGAAGAAG TGACTGGCTC
AAATGAGCTG GAGTGCCAGT CTCAAATTAA GGCAAGCTGA TAGATTTTGC TAGTTAATGT ACATCTATGT AAATGCGTGT
GCACATTTAA TTTCAACCAT CAACCAATTT TATACGTCCA ATCTTATATT GTGTTTAACT TGATTATCAA ATTTGATGAA
AAAGTTTATG GTGTAACACT CTGGCTGAAT AGGGGTTTTA TGATGTAGCT CAGCCTGGAT TAGAATGATT TCTCAAACCT
GAAAAGTAAA GTAACACAGT GAAATATTGT AACAAATAAG CACTAGCTCA TAAAGTTATT GTGCAAACGA ACAGAATGAT
TATATCCAGG ATTTTTCTGT AAAGTGGAAT ACCAATGTTT AATTGACTCA AGATTAACGT GGAACTTCAG TATTTCTGTC
AAAATATTGC ATTTGAAGTG CTGAGTCATG CATTACTTGT TGAACTAATT ATGTTTTTTC ATACATTGTA CACAGCGTTA
CAAAAGAGCA CTTCAATGTG AGAGTTGTGG AAATTGCTTT CCAAATAAAG ACCCAAGCAT GATGGTGTAT GTAATGGAAC
AACTTGCTTG CAGACAGTGT GCTAAGGTAC ATATGGCAAA ACTACTTGAT TGCTTATGTT ATGGTGGTAA TGATAAACAG
TTAACATGGA TAATGTAGTC CTTACTCTAC TTTCTGTACC TGCAGATACT GCGGTCCAAA GAGTATTGTG GTGTATGTTT
GAAAAGCTGG CAACATAAAT GTGGAGGAAG ATGGGTAAGA TAGTATGCAC TTATTAAAGC AATAGATTTA TCTCCTCGTT
TCCAACCCTG CAAATCTGAT GATGAAAGTG CTTACTCAGG TTTGTTGTCA TGGCTGTGAA AGTTGGGTTC ATGCAGAATG
TGACAAAAAG TGCAGCAACC TCAAGGTTAT GCTTTTCTCA TAATTAAAAA ACAAATGCAT CATCAGTGCT TTATTAGGTG
AATATCTAAC ATGCTCACGA TTTAATGCTA TAGGATCTAC GAGACAACAG TTATTTCTGC CCTTATTGTA GAGTTAAACA
GAACTCAAAT CTGTCCAGCA AGAAGACAAA ATCTTATGAA CATAGGTGGG GCACAAGTCT AGAACTATTA TTTTGTGGCA
TTTCTGTATT GAAAGGTTCT ATTTATTGAC TCAAGAGTGA TATCTATAAT TCATTTGTGA AACAGAACTG ACAATTCCAC
ACAGAAAAGT AGCAAGCCTG ACAAAGTTGC AGTTATCTGT TTTGGCATGG AAGGAACTTA CCTACGAGAT CTTGAACTGT
AAGCACCAAT TTATGTTAAC TGTATATATT TTATCATTTA TGGCATGCAT GCAGCACCAT CTCTTCTTTT GTTAATGGTC
TATTAGTTAC ATGATTTATC CCTTCCTTTT TTTGCTTACC CATCTTACTG TACTTACTCA TGTTCATCCG TTTGTATTAT
TGCATTTATC CCATGATGTA ATTCTGGCGT TCATTTCTTG TATATTTGAT TCTACTTATG TCATTTGTAA AACCTTTTTT
TGCAGAATTT CTTGCCATTG TGGTCCATGC AAGGGACAAA AATTTTTGTT CAATGAATGG GAACGGCATG CTGGCTGCAG
AAGTAAAAAC TGGAAGTCAA GTATTAAAAT CAAGGACACG CTTATGCCGT TTGGAAAATG GGTGCGTTCA GTACCCTCAA
CATAGTGCTC TTAATAGTGT TTTTAACATA TGCTTTGTAG GCCTTCATTG TTTTGTACTT ATGTTTGCTT GTGCATAATT
GTGAAACACT CTCATTTACA GATAGAGCAA CATCAATCAA GTTCATATTC CACAAATCCT GCAAAGCGCT CCTCTCAGAA
AATGAAGAAA CAAAAGCTTC TTGATTTGCT AAGTGGTAAC TCAACTTCAA TTTAGATCTT CCAAGTTGCC TGTAGTATTG
AATGATCCTT CTCACAAGGG AATTGGATTG ATGGAGTTAA AATTTATTTA CATTTTACAG AACCATATGA TACTGTAAAT
GTAAAATGGA CAACAGAAAG ATGTGCAGTC TGTAGATGGG TTGAAGACTG GGATTACAAC AAAATTGTAA TCTGTAACAG
GTAGTTAAGT TTTTGTTACG AGAAATGTTT TTCTTAACTG TGAAATCATT TTGAAATACG GAACAAACTC TGAACTTGAC
TAACAATATT CACGTTCAGA TGCCAGATAG CAGTTCATCA GGAATGCTAT GGCGTGAGGG GAAAGCAAGA CTTCACCTCA
TGGGTTTGTA GGGCTTGTGA AACACCTGAT CAAAAAAGGG AGTGTTGTCT TTGCCCTGTA AAAGGTATAT ACCACTGACA
TATATGTTTC AAAAGTATTC CATAAGCCTG CCCTTCATTA AGAGCAGTGA ACAGATAATA ATAATTGTGT ATACAGCTTT
GTTTTACAAG CCTTAGTCCG TTAAGCTGAA CAACATTAGT GACATTATGT TTATATAAAA GTTCACTGTT CAGTTTGTTT
GTTCTTCCCT TCTCAACTAG TAGCATGAAT ATTTAGATTT ACCTAATATT GAATCACACC AGACTAGAAT GAGTTTGTCG
ACTCAGCTTT CTTTTTATCT AATAAAAATA TATTTCTAAT AAAAATATAT TTATATTTGA GTAGCTGTTA ATCACTATTC
ACTAACCTGG TTTTTTGTGA CTTCTGTACT TTTTAGGTGG TGCACTGAAG CCAACAAATG TTGATAACTT GTGGGTACAT
GTGACATGTG CATGGTTTCA GCCACAAGTT GCTTTTGCTA GTGATGAGCT GATGGAACCT GCTATTGGGA TATTGAATAT
TACGCCTTTG CTATTCATGA AGGTAGTATA ATTGGATGAT ATATTAAGTG TCTTAAGAAG ATTAATCTTG AACAATATTA
AAATGTCTTG TATATTGAAG TTGAACTACA AAACTCTAAT TATGCTTATT CTCATCCATT GCTCCAGATG TGTGTCATTT
GTAGGCAAAT ACATGGTTCG TGTACACAGT GCTACAGGTG CTCAACTTAT TACCATGCCA TCTGTGCATC AAGGGCAGGC
TATAGGATGG AGGTACACTA ACATTAACTA TAACCAGCTG ATTACTTTTA TGTTGATGAG TGTGTTGGAG TTTGTACTTC
AATTTTGCTT GCATCTTTTA TTCTTCTCAG TCTTTACATA CTCTGTTTTT CATGGATGCA GATACGCTGC TTGGAAAAAA
ACGGCAAACA GACAACAAAC AAGATTTCAT ATTGTGCTCA TCATCGGTAA TGGCTTTATT TCTGAATGCA GTAGTGAAGC
ATTTAGCTTT CCGCATCAAT TTTTGCGTCA TATTTAGTTT GCTTAGAATC AATAATTTTG ATAATTCAAA CACTTGACAA
TAAGGTGCCT TTGTTTAGAA TCCATAGTTT AGTTTGCTCT TTTCATCTTA TGGAGAGTTT GCAAGTATCT GACTCCACAT
TTCTGTGCAG GGCCCCTAAT CCTGACAATG TTTTGATAAT TCAAACTCCT GCTGGAACTA TCTCTTCAAA AAAACTTGTT
CAGAGCAATG GCACTGTAGC TGCTTCAAGG CTGATTAGGA AAGATCTTCC CAAGGATTCA GTGTCAGAAG TTGAAATTTC
AGAGAACTTA TCTGCAGCAA GATGTCGGTT TTATGTTAAG AAAGAACTAA AGGTTTGCTC TTGTATTAGA TTATGATTTA
AAATTTTAAT AAAAATGCCT TATGTTTTAG TTGAAAGAGG TTTGATGCAA CTTTATGCCT GCTAGAAAAG AAGTCGTAAA
ACTAGCATTT TAGCATGCCA ACATAAGTGA CTGTTGCAAA AGAAGTTCCA CGCTGTAGTT TAGAGGACAT TATTGTTATT
TTATGCTATT TCTATGCAAA ATAGAGCGAG TAACGCGTAG GTGCACTATA AGATGAAATA TTGCCTGTGC TTCATTCATG
AAAGGAGATT TGTCCCCAAA GATGCGACCT GGTCCAATCA TGAGTAACGC TAGTCCAGGA TCTTGACTGT TGGTTGTTGC
ATGCTTACAT TGTAGCAGCA TTCCAACATC AATTACATGA GGATCTTAAG TTTTGTTTGT ACTGATGTTT TATAAAGATG
CTTTTTTTAT GTTATGGTAT ATGTGGGCCT GTTGGTCTGT AACTAGGAAC TGTTGGCTTG ATTGACATGC AGAGATCTCG
GGAGGGAGCA ATTGCACACC GTGTAAGGGG ATCCTGTCAA CATCGATGGG ATGAAATCGA CAGTTTGAAT CCACCTAGGG
TAATTCTGTG ATTTATTAGA TAACTGTGTC AATCCTTAAG TCAGCTTTCT TGTAAACAAG TCTGTACTTC TCTGCAGGAA
GAGAGGGATC CAGAGTCCTT TTCTACTTTT AAGGAGCGTC TACACTATCT GCAGGTTTGT GCCTTACTAA TCTCTATACC
TTCTATATCA ATAATATATG TATTTAATTT TTTCATTGTT TCTTTCAGAA AACAGAGCAT ACCAGAGTAT GCTTTGGTAG
GTCAGGAATT CATAGATGGG GACTTTTTGC TCGTAGGGGC ATTCAAGAAG GAGAAATGGT ACTTACAAAC AGAACTATTG
TATGCCATGC AAATGCTTTT TAGGAATGTG GCACCTAAAT GTTGGCAGGC TCGACTGTAA TGGTGTTGTT CTGTTTCTAC
CTTTTATTCA GGTGCTCGAG TATAGAGGTG AGCAGGTCAG ACGAAGTGTT GCTGATTTAA GGGAAGAACA ATATCGTGTA
CAAGGCAAAG ATTGTTATGT AAGTCATTTT CCATATCATT TTGCTTGATT GGTGGTCTGA TGTATTTGAT GAGTGCGAAT
GTTTCTATGA AATATCACCA TCTATATATA AGCATACAAT TCATCGCCAT GACTAAGAAC TTGATGCATT TACTGGTAGC
TTGGTTTGCT GATATTTTTT TCTCATCATC CAAGCTAATA CTATGGGGGT ATGACTGGAT TAGGCTCTAC AAAAGGGTTG
AATAGTTTCA TATGTGATAt actccctccg tttcaggtta taagactttc tagcattatc catattcata tagatgttaa
tgaatctagt cacacatata agtctagatt cattaacata tatataaatg tgagcaatgc tagaaagtct tataatacga
aatggaggaa gtGGCTTTCA ATCAGCTATC GTATGTATGT AGAAGATACA CATGGCATTA GTAATCATAC GATAGACTCT
TATTTTGAAA TTTATGATGG TATCCCTATC TTATAATTCG CCTAATATTA ATTGCATCTT ATTGCTGTCT TTTGTATTCT
CAGCTTTTCA AAATCAGCGA GGAAGTAGTC GTTGATGCCA CAGATAAAGG AAACGTGGCA CGCTTGATTA ATCATTCTGT
AAGGATTATA TATACCCCCC TAATCCCACT CTAGTTTCTG AAATAGTAAA CGCGCATATG ATGTTTTCGT GTTTTATTGC
AGTGCACTCC AAACTGCTAT GCAAGGATTA TGAGTGTGGG GCATGACGAG AGCCGTATTG TCCTAATCGC CAAGAAAAAT
GTCTCTGCCG GCGAAGAGCT AACGTATGTT GCAAAATACA AAGCTTATTT CTTTATCTTA GCATAGCTGC AACTCAGAAA
GGAAGTACAT AATGACTAAC CATGTGTTTG CTTCCTAAAT TTAGGTATGA CTACTTATTT GACCCTGACG AGGCTGATGA
TCGCAAAGTT CCTTGCCTCT GCCAAACGGC TAATTGTCGT AAATTCATGA ATTAGTTTAC TGTAGATGTC AAATTGGCCA
TTAGTTTACT GTTCTTTCTT TCTTTCTTTC TTTTTTCTGG GTTGGCTGGT GGTATATGCT TTACCTTGTT CTTTGTTGCT
TCCCCATTCT TTAACATAGC ATTTAGAAAA TAAGTTTAGC TATAGCTCAG AAGCGCGAGC TTCCATCCCT GTAAATGGCA
CTAATTTATC GATTACAGTC GTTCTTTTCT AATGCAAAAA ATTTTGCCCC 

Locus: Os01g0655300

Loading...

Locus: Os01g0655300

Loading...