Os01t0658400-01

Locus

Os01g0658400

Description

Ubiquitin-conjugating enzyme E2

RAP-DB Gene Symbol Synonym(s)

UBC5A, OsUBC5a, OsUBC14, UBC14

RAP-DB Gene Name Synonym(s)

UBIQUITIN CONJUGATING ENZYME 5A, Ubiquitin conjugating enzyme 5a, Ubiquitin-conjugating enzyme 14

CGSNL Gene Symbol

UBC5A

CGSNL Gene Name

UBIQUITIN CONJUGATING ENZYME 5A

Oryzabase Gene Symbol Synonym(s)

OsUBC5a, OsUBC14, UBC14

Oryzabase Gene Name Synonym(s)

Ubiquitin conjugating enzyme 5a, Ubiquitin-conjugating enzyme 14

Transcript Evidence

AB074411

AK063826

AK099284

Protein Evidence

Q8S920

Literature

PMID: 12028574

PMID: 25902049

Note

Manual Curation

March 14, 2016

Functional domain (InterPro)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme E2 (IPR000608)

Ubiquitin-conjugating enzyme, active site (IPR023313)

Full-length cDNA

001-122-A09 (Online Clone Ordering)

J023129D13 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0658400-01)

Others

Oryzabase (13912)

Transcript

767 bp

>Os01t0658400-01 Ubiquitin-conjugating enzyme E2
TCCCCCAACTCCATTATTGATTCTTGCAAGGAGGAAGAGCAGCTAGAGGCGAGGCAAGAA
AAGAAGTGAAATCTCTCCGTTAGACAGGAAGAGGAAAAGCAAGGGGGAATTGGGGATGGC
GTCAAAGAGGATACAGAAGGAGCTCAAGGATCTGCAGAAGGATCCCCCTACATCATGCAG
TGCAGGTCCTGTTGGTGAAGACATGTTCCACTGGCAGGCAACGATAATGGGTCCATCTGA
TAGCCCATATGCTGGTGGAGTTTTCCTAGTTACCATCCACTTCCCTCCTGATTATCCCTT
CAAACCACCCAAGGTGGCGTTTCGCACCAAGGTTTTCCATCCAAACATCAACAGCAACGG
GAGCATTTGCCTTGACATCCTTAAGGACCAATGGAGCCCAGCACTAACCATTTCCAAGGT
GTTGCTGTCAATCTGTTCCCTGCTGACTGATCCGAACCCTGATGATCCTCTGGTCCCTGA
GATCGCCCACATGTACAAGACAGATAGGCACAAGTACGAGAACACAGCAAGGACCTGGAC
TCAGAGGTACGCCATGTAGCACCTCAGATATCGATGGACATGTCGATGTTGTAACAACAT
TATCAACGGGTGTGTCTCCCTCTCGCCTTGTGTGGTGTAAGGATCAAAACCGGCTTTGCA
GTGCACTCTTGGTGTTGCTCCATTGTGTCACTCACTCATTGCAGTGATTTCGAATAGTAT
CAAACTGGTGGTTTTTTTCGGTCAGATAATGTTTGCAACTTGCCAAC

CDS

444 bp

>Os01t0658400-01 Ubiquitin-conjugating enzyme E2
ATGGCGTCAAAGAGGATACAGAAGGAGCTCAAGGATCTGCAGAAGGATCCCCCTACATCA
TGCAGTGCAGGTCCTGTTGGTGAAGACATGTTCCACTGGCAGGCAACGATAATGGGTCCA
TCTGATAGCCCATATGCTGGTGGAGTTTTCCTAGTTACCATCCACTTCCCTCCTGATTAT
CCCTTCAAACCACCCAAGGTGGCGTTTCGCACCAAGGTTTTCCATCCAAACATCAACAGC
AACGGGAGCATTTGCCTTGACATCCTTAAGGACCAATGGAGCCCAGCACTAACCATTTCC
AAGGTGTTGCTGTCAATCTGTTCCCTGCTGACTGATCCGAACCCTGATGATCCTCTGGTC
CCTGAGATCGCCCACATGTACAAGACAGATAGGCACAAGTACGAGAACACAGCAAGGACC
TGGACTCAGAGGTACGCCATGTAG

Protein

148 aa

>Os01t0658400-01 Ubiquitin-conjugating enzyme E2
MASKRIQKELKDLQKDPPTSCSAGPVGEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDY
PFKPPKVAFRTKVFHPNINSNGSICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPLV
PEIAHMYKTDRHKYENTARTWTQRYAM*

5'UTR

chr01:26784267..26784353 (- strand) : 87 bp

chr01:26784144..26784171 (- strand) : 28 bp

CDS

chr01:26784074..26784143 (- strand) : 70 bp

chr01:26782403..26782530 (- strand) : 128 bp

chr01:26781571..26781675 (- strand) : 105 bp

chr01:26781321..26781461 (- strand) : 141 bp

3'UTR

chr01:26781113..26781320 (- strand) : 208 bp

FASTA

>Os01t0658400-01 class=Sequence position=chr01:26781113..26784353 (- strand)
TCCCCCAACT CCATTATTGA TTCTTGCAAG GAGGAAGAGC AGCTAGAGGC GAGGCAAGAA AAGAAGTGAA ATCTCTCCGT
TAGACAGGTT TGTTTTCCTG CGAGTGCTCT CTAATTTGCA CTGATTAAGC TTTGATGATG CTTGATTTGT GGTTTGATTG
TTCTTCTTGT TGTTGGAGAT AGGAAGAGGA AAAGCAAGGG GGAATTGGGG ATGGCGTCAA AGAGGATACA GAAGGAGCTC
AAGGATCTGC AGAAGGATCC CCCTACATCA TGCAGTGCAG GTCTTGCTTT CTTTCTTTTG CTTGCTTCTT TTGGGCGTGG
ATTTTGCAGT TCTAGGCCAT ACATCTTGCA CAGGAGTCAG ATTTTTGTAC ATGTGCTTCT GAATGACTTC TTTGTCCACG
TGCTTGCTGC TTTGCCGTAG AATAGCAATG GAAAATTGCT CTCCAATTTG TCATATACAT CAAAGGGGCT TAGCTTAGCA
GTATCTGGAG TAACTCTCTG TACTCAGCTT TGCCCCAGCA AAAGAGGGGA AAGACAGATC ACTGTATGAT TAGAGTTTTC
ATCTTATGAA GATTACGGAT GGAGGTTTTA TATATATATC GATTAAGATT AATACGGCAG AGTTTGTCTG AACGTACTCA
TGCAGGGATT AGTTTATGCT ATTATGATTG ACAGGGATAC TATATTTGCC CTGATGAATT CTGGTAGAAT TACTTCCCTT
TCCATGGCGG ATATAGGCTG GTGTTGTTGT TATTGTTGTG ATTTAGTCTA CTTTACAAAC TAAATCTCAC CATCCAAGTA
TGCTCAAGAA GTGTCAATTA ACTGAGCTGA ATATTGCATA TAGGGTGCTG TGCGATTTGT ATTCTGAAAT GTAAATGTTA
CCTGTCAAGT GCTTTGTCAA AGGAGTTGCT GGTGTGGTAC TATAAATACC ATGAGTATCA AATCGGACTA TTCCTTCTAA
TTTAGCTCAT CATTTACTAA TATAGCATAA AACAATGGAA ATGTAGTTCA GTATAGAAAA GTGATTAGCT TGCCTTATTC
GAGAGAAAAC TAGTTGGTTG TCTAGTTGTT ATTCTTCATC TTTGTTTCCA ATGATCCAGG AGAACTTTTA TACCAAAACA
ACTGCATCCA TGCTGCATCT TTGTTTCTAG AACCCAGGAT CTGTCAGACC TGTCATCCTG TCCATTGGTC AGTTCATATG
CTTTTATCTT TTGTAGTGGT TCTACTAGTT TTTAAAATTT ATAGCAGGGC CCAAAATATT CAATAGAATA AACTTAATTT
GTTAGACTAC TTGTATGAAC TTTCTTCGCC TTATGGACAG GTGGCCTTCA CTCTTGCACT TTAAACTTCG TTCAACTAGT
TGGATCGCAT GTGCCATGGC GGCCACGCTT ACACATTGGA AACATAAGTA CTATTTAGTG TGGCTAGAAT AAGTTTGGTC
CTTTGAGCTT GGAGCTCACC CTGTCCATAC CTGTAAGAAG TGACAATTTC ATGTTGTCTA GTTGTATACC ATTAAGCGAA
AATGGTAACA TACTGTTATT TTGTCAAAGG AATGTCTTCC AATTTTCCTT GGGGTCAAGA AAAACCAACC TGAGCTTAAC
TGTGCACATA ACAATGGATA CTTGTCTTTT GTCCTTCAGC CTACTTCTGT TTTGTTTGAC CCTGTTTCAA TACCCTTATT
TATCATGCAA TTTCATCTCT AATCAAAGCT GTAGAGCTAG ACCATATGCC CATAATATGA TATGGTTATC AGGCAATGGA
TAGTAGCCTA GGACTGCACC TAGCCACATT TCTTAACAGT GATGATTTAT TACTATTTGA CAGGTCCTGT TGGTGAAGAC
ATGTTCCACT GGCAGGCAAC GATAATGGGT CCATCTGATA GCCCATATGC TGGTGGAGTT TTCCTAGTTA CCATCCACTT
CCCTCCTGAT TATCCCTTCA AACCACCCAA GGTACTTGGC AGTGACTTAT CACTCCCTTT TTATCTGTCC ACTATTCCTA
GTCATATATA TCTTCTTACT GCTGTTTTGT AAAACTGTAA CCCTATTCCT CTGCTCATTT CACATATAAA AATAGAACTC
TGGCAGATGC TATAATTTGT GGTTGATTGA ATTGGTGCTT TATTCATATT TTTTATTCTA TTCTAAAGCA TTCAAGGGAT
TGAGAACGTG GTATAAATTA TAAAGTTCAT GCTGAAGTTG TGCACAAGAG CAACTGGTGG CATGTCATGC CAGTAACTAA
CTTGTTGAAA ACATACAGGT TTAGACTTTA GAATGAACTT AAAATCAAAG CCACTTATGA ACCTGATTCT TGAAGATCAA
ATTTTGGGAA ATCAAGGTGG ATAAATATTG CAAGTTACGG CTGTAGTCAT GCAAAAGTGA AAGCATAGCT GCTGTCTAAT
AATGCTAATT CAGTTATGTT GCCAGTGTTC TCGAATCTTT GTAGTATATA ACAAAGTTGT TTCCTGGACT GTGCTATATA
ACCGAATAAT GGTTTGGTAG TGATTGTCTT CTCACTTATC ACTAAGGTGT TCTTTTACTT CATTCTGAAA GAATATCACT
TCAATTATAA ATTCTTATGG TTTCTGGTTT TCAGTCTGAA TATCCATTAA GTTCTATAGC TTTACAACAG CACCGAGACT
GACTGAAGAA TGTGACGTCT ATGATATGCA ATATGCAGGT GGCGTTTCGC ACCAAGGTTT TCCATCCAAA CATCAACAGC
AACGGGAGCA TTTGCCTTGA CATCCTTAAG GACCAATGGA GCCCAGCACT AACCATTTCC AAGGTTTCCT TTCTCGCTTA
ACGCTATTTT CCTTTTGCGA GGCGGTTGCT TGGTCTCTCG CAGTTGGGCT GAACGAATCC CGCAAAAACA TGTGCTCTCT
GCTTGCTTTC AGGTGTTGCT GTCAATCTGT TCCCTGCTGA CTGATCCGAA CCCTGATGAT CCTCTGGTCC CTGAGATCGC
CCACATGTAC AAGACAGATA GGCACAAGTA CGAGAACACA GCAAGGACCT GGACTCAGAG GTACGCCATG TAGCACCTCA
GATATCGATG GACATGTCGA TGTTGTAACA ACATTATCAA CGGGTGTGTC TCCCTCTCGC CTTGTGTGGT GTAAGGATCA
AAACCGGCTT TGCAGTGCAC TCTTGGTGTT GCTCCATTGT GTCACTCACT CATTGCAGTG ATTTCGAATA GTATCAAACT
GGTGGTTTTT TTCGGTCAGA TAATGTTTGC AACTTGCCAA C

Locus: Os01g0658400

Loading...

Locus: Os01g0658400

Loading...