Os01t0658600-00

Locus

Os01g0658600

Description

Similar to SBH2 (SPHINGOID BASE HYDROXYLASE 2); catalytic/ sphingosine hydroxylase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

BT009316 (DDBJ)

Protein Evidence

NP_563944.1 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Expression Databases

TENOR (Os01t0658600-00)

Transcript

840 bp

>Os01t0658600-00 Similar to SBH2 (SPHINGOID BASE HYDROXYLASE 2); catalytic/ sphingosine hydroxylase.
ACTAGCTTTCTAGTTGCAACGATGGGGTTCATCAGCGGCGAGGAGCTCGCCGTGACGCTG
GCGCCGGTGGCCGTGTACTGGCTCTACTCGGGGATCTACGAGGCGTTGGGGAGCGTCAGG
GCTCTGGACAGGTACAGGCTGCACTCGAGGAGGGACGAGGAGAGCAATAACATGGCGTCC
AAGAAGGAGGTGGTGAAGGGCGTGCTGCTGCAGCAGGCCATCCAGGTCGCCATCTCACTT
GCCGTGCTCAAGCGCCCCGGCAGCGGCGCCATCGTCGTCGTCGGCGGCGGCGGCGCTACT
GGACGTGGCGGCGCGGTTCGGGGTGGCCATGTTCGTGCTGGACGCGTGGCAGTACTTCGC
GCACCGGCTGATGCACTCGAGCCGGTACATGTACCGTCGGTTCCACTCGTGGCACCACCG
CGTCGTGGCCCCCTACGCGTTCGCGGCGCAGTACGGCCACCCCGTGGACGGCGTGCTCAC
GGAGGCGCTCTCCGGCGCCGCCGCGTACCTCGCCTCGGGCCTGCCCCCCCGCGCCGCGGC
CTTCTTCCTCGCGTTCGCCACCGTCAAGGGGATCGACGACCACTGCGGCCTCCTGGTGCC
CTGGAACCCGCTGCACGCCGCGTTCGCCAACAACACGGCCTACCACGACGTGCACCACCA
GCTCAGCGGCGGCCGGCGCAACTTCTCGCAGCCGTTCTTCGTGGTCTGGGACCGTCTGCT
CGGCACGCACGCCGGCTACACCGTCACCGCGCGGGAGAGGAACAACGGCGGCGGCCTCGA
GGCCAAGCCGATCTGCAACGATCGCCACGTTCTCCTGTAATGTCAACCTGTTTTTGCTGA

CDS

819 bp

>Os01t0658600-00 Similar to SBH2 (SPHINGOID BASE HYDROXYLASE 2); catalytic/ sphingosine hydroxylase.
ATGGGGTTCATCAGCGGCGAGGAGCTCGCCGTGACGCTGGCGCCGGTGGCCGTGTACTGG
CTCTACTCGGGGATCTACGAGGCGTTGGGGAGCGTCAGGGCTCTGGACAGGTACAGGCTG
CACTCGAGGAGGGACGAGGAGAGCAATAACATGGCGTCCAAGAAGGAGGTGGTGAAGGGC
GTGCTGCTGCAGCAGGCCATCCAGGTCGCCATCTCACTTGCCGTGCTCAAGCGCCCCGGC
AGCGGCGCCATCGTCGTCGTCGGCGGCGGCGGCGCTACTGGACGTGGCGGCGCGGTTCGG
GGTGGCCATGTTCGTGCTGGACGCGTGGCAGTACTTCGCGCACCGGCTGATGCACTCGAG
CCGGTACATGTACCGTCGGTTCCACTCGTGGCACCACCGCGTCGTGGCCCCCTACGCGTT
CGCGGCGCAGTACGGCCACCCCGTGGACGGCGTGCTCACGGAGGCGCTCTCCGGCGCCGC
CGCGTACCTCGCCTCGGGCCTGCCCCCCCGCGCCGCGGCCTTCTTCCTCGCGTTCGCCAC
CGTCAAGGGGATCGACGACCACTGCGGCCTCCTGGTGCCCTGGAACCCGCTGCACGCCGC
GTTCGCCAACAACACGGCCTACCACGACGTGCACCACCAGCTCAGCGGCGGCCGGCGCAA
CTTCTCGCAGCCGTTCTTCGTGGTCTGGGACCGTCTGCTCGGCACGCACGCCGGCTACAC
CGTCACCGCGCGGGAGAGGAACAACGGCGGCGGCCTCGAGGCCAAGCCGATCTGCAACGA
TCGCCACGTTCTCCTGTAATGTCAACCTGTTTTTGCTGA

Protein

273 aa

>Os01t0658600-00 Similar to SBH2 (SPHINGOID BASE HYDROXYLASE 2); catalytic/ sphingosine hydroxylase.
MGFISGEELAVTLAPVAVYWLYSGIYEALGSVRALDRYRLHSRRDEESNNMASKKEVVKG
VLLQQAIQVAISLAVLKRPGSGAIVVVGGGGATGRGGAVRGGHVRAGRVAVLRAPADALE
PVHVPSVPLVAPPRRGPLRVRGAVRPPRGRRAHGGALRRRRVPRLGPAPPRRGLLPRVRH
RQGDRRPLRPPGALEPAARRVRQQHGLPRRAPPAQRRPAQLLAAVLRGLGPSARHARRLH
RHRAGEEQRRRPRGQADLQRSPRSPVMSTCFC*

5'UTR

chr01:26790255..26790275 (+ strand) : 21 bp

CDS

chr01:26790276..26790506 (+ strand) : 231 bp

chr01:26791102..26791689 (+ strand) : 588 bp

FASTA

>Os01t0658600-00 class=Sequence position=chr01:26790255..26791689 (+ strand)
ACTAGCTTTC TAGTTGCAAC GATGGGGTTC ATCAGCGGCG AGGAGCTCGC CGTGACGCTG GCGCCGGTGG CCGTGTACTG
GCTCTACTCG GGGATCTACG AGGCGTTGGG GAGCGTCAGG GCTCTGGACA GGTACAGGCT GCACTCGAGG AGGGACGAGG
AGAGCAATAA CATGGCGTCC AAGAAGGAGG TGGTGAAGGG CGTGCTGCTG CAGCAGGCCA TCCAGGTCGC CATCTCACTT
GCCGTGCTCA AGGTTTGTCG TCTCACAACC CTCGACGTTC AGCTAGCTAG CTTTTGATTG TTGAGTGATC TTTGTTTGGA
ACCTCCTGCT GTAGATGGAA AATATTACTG TGTTTATCCA TAATGCAGAG AGCAAGAAAA AAAAAAAAGC AAATCCGTCG
CATTATGGAC GTGACGGCAT ACTGGTACAC CACTGAGTAC AGTCGCTAGC TCTAGCGGTT TCTACCCCAC ATCAGTAGGT
GATACGGCTG CATTGTTTAA GAAGAACCCC CTGATTCACC CATATCGGCA TATCTGCAGA CTGCAGTGCC TAGCTTCTTC
CGGCAAGAAG ATGAACAACA ACAGTGCAAC ACTAACTTCG CATCACCCTG CACTCCTGCC TGACAAAACG CATTAATCGA
TCAAGAGTAA CCTTGGCCCT TAAACTACAC TACAGGTTCT GTACACGCGT GCGCACGGTG GAGCAGAGCA CAGCTCGTGA
TACGTGATAG TTACAAGGCT GCCTAGTTAC AACTGGTTGA TTGATCTTGT CTTTCTTTTA TCGATCTTAC GCAGCTGACA
AGTGAGAAAG ACGGTGGCGC CGGCGACGTC AAGGCCGGTC ACGCGAGCGC CCCGGCAGCG GCGCCATCGT CGTCGTCGGC
GGCGGCGGCG CTACTGGACG TGGCGGCGCG GTTCGGGGTG GCCATGTTCG TGCTGGACGC GTGGCAGTAC TTCGCGCACC
GGCTGATGCA CTCGAGCCGG TACATGTACC GTCGGTTCCA CTCGTGGCAC CACCGCGTCG TGGCCCCCTA CGCGTTCGCG
GCGCAGTACG GCCACCCCGT GGACGGCGTG CTCACGGAGG CGCTCTCCGG CGCCGCCGCG TACCTCGCCT CGGGCCTGCC
CCCCCGCGCC GCGGCCTTCT TCCTCGCGTT CGCCACCGTC AAGGGGATCG ACGACCACTG CGGCCTCCTG GTGCCCTGGA
ACCCGCTGCA CGCCGCGTTC GCCAACAACA CGGCCTACCA CGACGTGCAC CACCAGCTCA GCGGCGGCCG GCGCAACTTC
TCGCAGCCGT TCTTCGTGGT CTGGGACCGT CTGCTCGGCA CGCACGCCGG CTACACCGTC ACCGCGCGGG AGAGGAACAA
CGGCGGCGGC CTCGAGGCCA AGCCGATCTG CAACGATCGC CACGTTCTCC TGTAATGTCA ACCTGTTTTT GCTGA

Locus: Os01g0658600

Loading...

Locus: Os01g0658600

Loading...