Os01t0667200-01

Locus

Os01g0667200

Description

Mitochondrial sulfur dioxygenase, Abiotic stress response

RAP-DB Gene Symbol Synonym(s)

GLYII-1, OsGLYII1, GLYII1, OsETHE1, ETHE1, OsGLYII-1

RAP-DB Gene Name Synonym(s)

GLYOXALASE II-1, glyoxalase II-1, ETHYLMALONIC ENCEPHALOPATHY PROTEIN 1, ETHE1-like protein, ethylmalonic encephalopathy-1

CGSNL Gene Symbol

GLYII-1

CGSNL Gene Name

GLYOXALASE II-1

Oryzabase Gene Symbol Synonym(s)

OsGLYII1, GLYII1, OsETHE1, ETHE1, OsGLYII-1

Oryzabase Gene Name Synonym(s)

glyoxalase II-1, ETHYLMALONIC ENCEPHALOPATHY PROTEIN 1, ETHE1-like protein, ethylmalonic encephalopathy-1

Transcript Evidence

AK067930

Protein Evidence

Q5QLQ5

Literature

PMID: 25482779

PMID: 24410953

Note

Manual Curation

March 18, 2016

Functional domain (InterPro)

Metallo-beta-lactamase (IPR001279)

Full-length cDNA

J013127E08 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0667200-01)

Others

Oryzabase (9362)

Transcript

1481 bp

>Os01t0667200-01 Mitochondrial sulfur dioxygenase, Abiotic stress response
CATTAGCGGAAACCGGCGAACTGCCAACATCCCCTGCCCCCATCTGGTAGCTATCTCGTC
CTCCGTCCTCACCCGCCGCCGCCGCGACCGCGAGCTAAACCACGGCACCGCCGGCGACCT
CGTGGACCTCGCCTGTCGCCACATCATCGCTGCCGTCGCCTACTCGCCTCCCCTCCCCGA
CCCCGACCCGATCCGCTCCGCTCCCCATTTGTTTATTCCGGCGCGTGAGCTAATCACCGC
GAGGTCCACCGCCGCCGATAACACCCAAGCCAAGCGCGGTCGCTTCCGCGTCTTGATTTC
CTCCTCCTCCTCCTCCTCCCACTCGCGTGCGTACCTCCGCCTTATTATATAGCGCTGGCC
TGGGCGGGGCGGAAGAGCCAAATGGTGGCGCTGCTTCGCTCGTGCCGCCGCCTGATCCCG
CACCTGTCCGCCTGCGCCGCCGCCGCGCCGTCGTCGTCATCGTCGTGCGCTCCTCGGGCT
AGGCCGATCTCGCGGGGACTGCGGCTGCTGCCGGTGGTGCTCGCAATGGCGGGGTACAGC
AGCGGCTCCGCCGCGGAGGGGAGGAGGCTGCTGTTCAGGCAGCTGTTCGAGAAGGAGAGC
TCCACCTACACCTACCTCCTCGCCGACGTCGGGGACCCCGAGAAACCCGCCGTGTTGATT
GACCCTGTGGACAGAACAGTTGATAGAGATCTCAATCTTATCAAGGAGTTGGGCTTGAAG
CTAGTCTATGCTATGAATACCCATGTGCATGCTGATCATGTCACTGGAACAGGATTAATA
AAGACTAAGTTACCTGGAGTAAAGTCCGTGATTGCAAAAGTAAGCAAAGCAAAAGCAGAC
CATTTTATTGAGCATGGGGACAAAATATACTTCGGTAACCTCTTCCTTGAGGTACGATCT
ACTCCTGGCCATACTGCTGGCTGTGTGACTTATGTAACAGGTGAAGGCGATGATCAACCT
TCACCAAGAATGGCTTTTACTGGTGATGCCTTGCTTATACGTGCATGTGGAAGGACAGAC
TTTCAGGGAGGAAGTTCTGATGAGCTGTATGAGTCGGTGCATTCGCAGATTTTCACATTG
CCAAAGGATACCCTGCTTTATCCTGGCCATGACTACAAAGGTTTCACAGTAAGTACTGTT
GAAGAGGAGGTTGCGTATAATGCTCGACTAACAAAGGATAAGGAAACATTCAAGAAAATT
ATGGACAACTTGAACTTGGCCTATCCAAAGATGATCGATGTAGCCGTGCCCGCGAATTTG
CTCTGCGGTATTCAGGATCCTCCACCATCCAAGGTCTGAGCTGTTCCGGCTGAAGCTTTC
AAGCTGTTGTGAACTCACGGTCAACTCGAGAAGCTCGCAGCTATGTTGTACATTAAATAA
TCTGTTGTTAATTTGTAAGGCACTACTTGGGAACATTTCCGCTTCATGAGATCAACGGTA
ATAATAATAAACAGAGGCTAGCTTGCCTCTTGTCTTGTGCT

CDS

918 bp

>Os01t0667200-01 Mitochondrial sulfur dioxygenase, Abiotic stress response
ATGGTGGCGCTGCTTCGCTCGTGCCGCCGCCTGATCCCGCACCTGTCCGCCTGCGCCGCC
GCCGCGCCGTCGTCGTCATCGTCGTGCGCTCCTCGGGCTAGGCCGATCTCGCGGGGACTG
CGGCTGCTGCCGGTGGTGCTCGCAATGGCGGGGTACAGCAGCGGCTCCGCCGCGGAGGGG
AGGAGGCTGCTGTTCAGGCAGCTGTTCGAGAAGGAGAGCTCCACCTACACCTACCTCCTC
GCCGACGTCGGGGACCCCGAGAAACCCGCCGTGTTGATTGACCCTGTGGACAGAACAGTT
GATAGAGATCTCAATCTTATCAAGGAGTTGGGCTTGAAGCTAGTCTATGCTATGAATACC
CATGTGCATGCTGATCATGTCACTGGAACAGGATTAATAAAGACTAAGTTACCTGGAGTA
AAGTCCGTGATTGCAAAAGTAAGCAAAGCAAAAGCAGACCATTTTATTGAGCATGGGGAC
AAAATATACTTCGGTAACCTCTTCCTTGAGGTACGATCTACTCCTGGCCATACTGCTGGC
TGTGTGACTTATGTAACAGGTGAAGGCGATGATCAACCTTCACCAAGAATGGCTTTTACT
GGTGATGCCTTGCTTATACGTGCATGTGGAAGGACAGACTTTCAGGGAGGAAGTTCTGAT
GAGCTGTATGAGTCGGTGCATTCGCAGATTTTCACATTGCCAAAGGATACCCTGCTTTAT
CCTGGCCATGACTACAAAGGTTTCACAGTAAGTACTGTTGAAGAGGAGGTTGCGTATAAT
GCTCGACTAACAAAGGATAAGGAAACATTCAAGAAAATTATGGACAACTTGAACTTGGCC
TATCCAAAGATGATCGATGTAGCCGTGCCCGCGAATTTGCTCTGCGGTATTCAGGATCCT
CCACCATCCAAGGTCTGA

Protein

306 aa

>Os01t0667200-01 Mitochondrial sulfur dioxygenase, Abiotic stress response
MVALLRSCRRLIPHLSACAAAAPSSSSSCAPRARPISRGLRLLPVVLAMAGYSSGSAAEG
RRLLFRQLFEKESSTYTYLLADVGDPEKPAVLIDPVDRTVDRDLNLIKELGLKLVYAMNT
HVHADHVTGTGLIKTKLPGVKSVIAKVSKAKADHFIEHGDKIYFGNLFLEVRSTPGHTAG
CVTYVTGEGDDQPSPRMAFTGDALLIRACGRTDFQGGSSDELYESVHSQIFTLPKDTLLY
PGHDYKGFTVSTVEEEVAYNARLTKDKETFKKIMDNLNLAYPKMIDVAVPANLLCGIQDP
PPSKV*

5'UTR

chr01:27278176..27278556 (- strand) : 381 bp

CDS

chr01:27277903..27278175 (- strand) : 273 bp

chr01:27277072..27277200 (- strand) : 129 bp

chr01:27276848..27276955 (- strand) : 108 bp

chr01:27275908..27276042 (- strand) : 135 bp

chr01:27275651..27275692 (- strand) : 42 bp

chr01:27275430..27275489 (- strand) : 60 bp

chr01:27275310..27275363 (- strand) : 54 bp

chr01:27275196..27275220 (- strand) : 25 bp

chr01:27274932..27275023 (- strand) : 92 bp

3'UTR

chr01:27274750..27274931 (- strand) : 182 bp

FASTA

>Os01t0667200-01 class=Sequence position=chr01:27274750..27278556 (- strand)
CATTAGCGGA AACCGGCGAA CTGCCAACAT CCCCTGCCCC CATCTGGTAG CTATCTCGTC CTCCGTCCTC ACCCGCCGCC
GCCGCGACCG CGAGCTAAAC CACGGCACCG CCGGCGACCT CGTGGACCTC GCCTGTCGCC ACATCATCGC TGCCGTCGCC
TACTCGCCTC CCCTCCCCGA CCCCGACCCG ATCCGCTCCG CTCCCCATTT GTTTATTCCG GCGCGTGAGC TAATCACCGC
GAGGTCCACC GCCGCCGATA ACACCCAAGC CAAGCGCGGT CGCTTCCGCG TCTTGATTTC CTCCTCCTCC TCCTCCTCCC
ACTCGCGTGC GTACCTCCGC CTTATTATAT AGCGCTGGCC TGGGCGGGGC GGAAGAGCCA AATGGTGGCG CTGCTTCGCT
CGTGCCGCCG CCTGATCCCG CACCTGTCCG CCTGCGCCGC CGCCGCGCCG TCGTCGTCAT CGTCGTGCGC TCCTCGGGCT
AGGCCGATCT CGCGGGGACT GCGGCTGCTG CCGGTGGTGC TCGCAATGGC GGGGTACAGC AGCGGCTCCG CCGCGGAGGG
GAGGAGGCTG CTGTTCAGGC AGCTGTTCGA GAAGGAGAGC TCCACCTACA CCTACCTCCT CGCCGACGTC GGGGACCCCG
AGAAACCCGC CGTGGTGAGT AGTTGATGCT CTTGACCATC TGTTCGTTGT TCTGGGTATC AGTTGGGTAA ATGGAAGCCT
CTTTTATGGA TACCGTAAGC AGGATTACTC TTTCAGTGGC TACTGCAGAA ATGTAGATAC CAACATAAAT TAAATAGCAA
ACTAAATACT CCAAATAGGT ATAAGACTGG AATAATTGAT TATTACCTGT GAATTGTGGT ATCCCTAACT AATTTAAAGA
TCATCTTGCG TTTTTTTAAT GTCTGACAGT ACGCAAGATA TTGGCAATGT TGCAATCAGT GACGGTGATT ATAATTATCC
AGTTCAGGAG GTGCATTTAT AAACTATGAA AGATAATCAA ATTACTTGAT ATCATTCTGA TGGGTTACAT ATATTCATGT
TATCTTGGAC TTGGCACTAC ATTACATAAA TGCGCAATCT CGCTAATTTG TTCAAGAATC CCAAAACTTA ACCTTCTCCA
CGGTTTTGCT TAAGTATTTT CAAATAATTT GTTTTCTTAA TTATCGTATT GATTGAGCCA AAATGAAAAA AAATGTAACC
TTTTTCTCTA TATATGTGAC AGACTAGACT AGCGCAATAA GCACTAAACT AAATCAGAAA AAAATATTGA TGCTGTTTTT
GTAGATTTGA TGTTTAGCTA TAGTTGCTTC CATTTTGTTG ATCACCTCCC TAATGTCCTT GGTTTTGTGT TATCAGTTGA
TTGACCCTGT GGACAGAACA GTTGATAGAG ATCTCAATCT TATCAAGGAG TTGGGCTTGA AGCTAGTCTA TGCTATGAAT
ACCCATGTGC ATGCTGATCA TGTCACTGGA ACAGGATTAA TAAAGGTAAA TAGTTCCAAC CTCTGAACTT CTCGAGATCT
TGTGATATGT TTTCTTTTCA TAGTCTTGAT ACTTTGTTCT CTTTGGTCAT AACATGGTCA TCTGATGGAA TGTACTTGCA
GACTAAGTTA CCTGGAGTAA AGTCCGTGAT TGCAAAAGTA AGCAAAGCAA AAGCAGACCA TTTTATTGAG CATGGGGACA
AAATATACTT CGGTAACCTC TTCCTTGAGG TATAATCCCA TTTTAATTAG CTGTTTGGCT ATGTGTTTCT TCTTTCATTT
AGTAAGCACT GACATAATTT ATGGGGACTA TTGAAACTAG TCCTTTTGAG CTCTCTGGCT GAACTTAATA AACATTAATC
CTGAACTCTC AACCACCCCA CCCCCACCCC TCTGAATTTT ATGGAGTATG GCAATTGCAG CAGTTCCCCT AGAATCTCAC
TCTATACAGG CTGCAAATAT GAACGGATTG TCTACTTCTA ATTATAAAAG GGCTTTTTCT GTATATGGTC ATCTGAGTGG
TCTGTTTGTG GTGGTGGTGG TCAGAGACAT AATTTATGTG ATCTATTCAT ATATGTATAT TTTGTTTCCT TAATCATTTT
AACTTTGCGG TGTTTGTCAG TAAGACGATA AACAGTTGTC CACACAGCTA ATTCAGGACT TAAAAACTGT GCACTTTTGT
AGGTTAGACT TGTATAACAA ATTTAAAAGT ATTTTCCCTT GGTTCATACA AAATGAGGTA ATGTGAATGT TTATGGAGAT
ATGGTGTTTG GGTGATATTA AATATTTTCT CAGCTGTGCA ACCATTGTTT GTGGATATGT TGATTCTTGA AATTTGTGTT
CTTATTGAAA GTTTGGCTTT AGGTATTTAT AGCATATCCA TGACAGATAT AATATGAATA AGAAAACGTA TACTGTCAAC
CAAGCTGCTG AATAAAACAG CATTGAAAAT TATGCATCTT TGTTCTATCC GTCATGTAAT ATTTTGGATA TGATGAAATT
TTCTGATATC AGAAATGGCA AAATTGCTTT TTAGGTACGA TCTACTCCTG GCCATACTGC TGGCTGTGTG ACTTATGTAA
CAGGTGAAGG CGATGATCAA CCTTCACCAA GAATGGCTTT TACTGGTGAT GCCTTGCTTA TACGTGCATG TGGAAGGACA
GACTTTCAGG TAATTGTTAC CACTGCCACT TCTTAATGGC TTAGCGATCA GGAACTGTTC TGTTTGAAAT CTAAAGATAC
CGTGGTTAAT TAAATTAATA GGGACTGAAT GTATTCTGTC TGTTAGTCAA GCATAAGTTT GCTTGCATAC GGAAGCTCAG
AATTCATGTT CTAGAGAAAT TCTGTTTAAA CATAGATTGT TTATTTTGTT TTCTGGTATT ACAGGGAGGA AGTTCTGATG
AGCTGTATGA GTCGGTGCAT TCGCAGGCAA GTATGCATTA TCCTTTTTTT AAGACTAAAT ACACATCAGC TTATAGAATA
GCATACCACT TTTTTTAGGC AATCATACAT AATATTTTGA AACTAGGCAC ACATCATCTT CATACATAAT ATGAAGGGTA
GGTAGCTGAC TTTTTTATCC TTATCAGATT TTCACATTGC CAAAGGATAC CCTGCTTTAT CCTGGCCATG ACTACAAAGG
TTTCACAGTA AGTGCTCACT TTCTTAAAGC TCACTAATCA AGGTACCAGG CACTTGACTA TTTTATTTTG CAGGTAAGTA
CTGTTGAAGA GGAGGTTGCG TATAATGCTC GACTAACAAA GGATAAGGTA CATGCTACTT TGGCTAATTC TTTACACCCA
TCTAACTAAT AAAAGCTATA TTTTTTCTGA TATTAATTTA CTTGTTATGT TTATAGGAAA CATTCAAGAA AATTATGGAC
AGTAAGTTTC AGAGTCTTTA ACAATGGATA TGTGCCTTTT CTTCTCGCAT CAATTTATGA ATATCCATTT TCATTATACT
TCTGCTCACG TAGGCACTTA CCAGATCAAA TCTTACCTCC ACTTTTTTAA TACACTAAAC AAGATCTGGA TCGTTTACTC
TGTCCACTTG CAGACTTGAA CTTGGCCTAT CCAAAGATGA TCGATGTAGC CGTGCCCGCG AATTTGCTCT GCGGTATTCA
GGATCCTCCA CCATCCAAGG TCTGAGCTGT TCCGGCTGAA GCTTTCAAGC TGTTGTGAAC TCACGGTCAA CTCGAGAAGC
TCGCAGCTAT GTTGTACATT AAATAATCTG TTGTTAATTT GTAAGGCACT ACTTGGGAAC ATTTCCGCTT CATGAGATCA
ACGGTAATAA TAATAAACAG AGGCTAGCTT GCCTCTTGTC TTGTGCT

Locus: Os01g0667200

Loading...

Locus: Os01g0667200

Loading...