Os01t0667200-02

Locus

Os01g0667200

Description

Similar to Glyoxalase II.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GLYII-1

CGSNL Gene Name

GLYOXALASE II-1

Oryzabase Gene Symbol Synonym(s)

OsGLYII1, GLYII1, OsETHE1, ETHE1, OsGLYII-1

Oryzabase Gene Name Synonym(s)

glyoxalase II-1, ETHYLMALONIC ENCEPHALOPATHY PROTEIN 1, ETHE1-like protein, ethylmalonic encephalopathy-1

Transcript Evidence

AK104104 (DDBJ, Best hit)

AK104749 (DDBJ, Best hit)

Protein Evidence

B9EYI3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: hydrolase activity (GO:0016787)

Functional domain (InterPro)

Beta-lactamase-like (IPR001279)

Full-length cDNA

006-202-B10 (Online Clone Ordering)

001-038-F04 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0667200-02)

Others

Oryzabase (9362)

Transcript

1107 bp

>Os01t0667200-02 Similar to Glyoxalase II.
GAGCCAAATGGTGGCGCTGCTTCGCTCGTGCCGCCGCCTGATCCCGCACCTGTCCGCCTG
CGCCGCCGCCGCGCCGTCGTCGTCATCGTCGTGCGCTCCTCGGGCTAGGCCGATCTCGCG
GGGACTGCGGCTGCTGCCGGTGGTGCTCGCAATGGCGGGGTACAGCAGCGGCTCCGCCGC
GGAGGGGAGGAGGCTGCTGTTCAGGCAGCTGTTCGAGAAGGAGAGCTCCACCTACACCTA
CCTCCTCGCCGACGTCGGGGACCCCGAGAAACCCGCCGTGTTGATTGACCCTGTGGACAG
AACAGTTGATAGAGATCTCAATCTTATCAAGGAGTTGGGCTTGAAGCTAGTCTATGCTAT
GAATACCCATGTGCATGCTGATCATGTCACTGGAACAGGATTAATAAAGACTAAGTTACC
TGGAGTAAAGTCCGTGATTGCAAAAGTAAGCAAAGCAAAAGCAGACCATTTTATTGAGCA
TGGGGACAAAATATACTTCGGTAACCTCTTCCTTGAGGTACGATCTACTCCTGGCCATAC
TGCTGGCTGTGTGACTTATGTAACAGGTGAAGGCGATGATCAACCTTCACCAAGAATGGC
TTTTACTGGTGATGCCTTGCTTATACGTGCATGTGGAAGGACAGACTTTCAGGGAGGAAG
TTCTGATGAGCTGTATGAGTCGGTGCATTCGCAGATTTTCACATTGCCAAAGGATACCCT
GCTTTATCCTGGCCATGACTACAAAGGTTTCACAGTAAGTACTGTTGAAGAGGAGGTTGC
GTATAATGCTCGACTAACAAAGGATAAGGAAACATTCAAGAAAATTATGGACAACTTGAA
CTTGGCCTATCCAAAGATGATCGATGTAGCCGTGCCCGCGAATTTGCTCTGCGGTATTCA
GGATCCTCCACCATCCAAGGTCTGAGCTGTTCCGGCTGAAGCTTTCAAGCTGTTGTGAAC
TCACGGTCAACTCGAGAAGCTCGCAGCTATGTTGTACATTAAATAATCTGTTGTTAATTT
GTAAGGCACTACTTGGGAACATTTCCGCTTCATGAGATCAACGGTAATAATAATAAACAG
AGGCTAGCTTGCCTCTTGTCTTGTGCT

CDS

918 bp

>Os01t0667200-02 Similar to Glyoxalase II.
ATGGTGGCGCTGCTTCGCTCGTGCCGCCGCCTGATCCCGCACCTGTCCGCCTGCGCCGCC
GCCGCGCCGTCGTCGTCATCGTCGTGCGCTCCTCGGGCTAGGCCGATCTCGCGGGGACTG
CGGCTGCTGCCGGTGGTGCTCGCAATGGCGGGGTACAGCAGCGGCTCCGCCGCGGAGGGG
AGGAGGCTGCTGTTCAGGCAGCTGTTCGAGAAGGAGAGCTCCACCTACACCTACCTCCTC
GCCGACGTCGGGGACCCCGAGAAACCCGCCGTGTTGATTGACCCTGTGGACAGAACAGTT
GATAGAGATCTCAATCTTATCAAGGAGTTGGGCTTGAAGCTAGTCTATGCTATGAATACC
CATGTGCATGCTGATCATGTCACTGGAACAGGATTAATAAAGACTAAGTTACCTGGAGTA
AAGTCCGTGATTGCAAAAGTAAGCAAAGCAAAAGCAGACCATTTTATTGAGCATGGGGAC
AAAATATACTTCGGTAACCTCTTCCTTGAGGTACGATCTACTCCTGGCCATACTGCTGGC
TGTGTGACTTATGTAACAGGTGAAGGCGATGATCAACCTTCACCAAGAATGGCTTTTACT
GGTGATGCCTTGCTTATACGTGCATGTGGAAGGACAGACTTTCAGGGAGGAAGTTCTGAT
GAGCTGTATGAGTCGGTGCATTCGCAGATTTTCACATTGCCAAAGGATACCCTGCTTTAT
CCTGGCCATGACTACAAAGGTTTCACAGTAAGTACTGTTGAAGAGGAGGTTGCGTATAAT
GCTCGACTAACAAAGGATAAGGAAACATTCAAGAAAATTATGGACAACTTGAACTTGGCC
TATCCAAAGATGATCGATGTAGCCGTGCCCGCGAATTTGCTCTGCGGTATTCAGGATCCT
CCACCATCCAAGGTCTGA

Protein

306 aa

>Os01t0667200-02 Similar to Glyoxalase II.
MVALLRSCRRLIPHLSACAAAAPSSSSSCAPRARPISRGLRLLPVVLAMAGYSSGSAAEG
RRLLFRQLFEKESSTYTYLLADVGDPEKPAVLIDPVDRTVDRDLNLIKELGLKLVYAMNT
HVHADHVTGTGLIKTKLPGVKSVIAKVSKAKADHFIEHGDKIYFGNLFLEVRSTPGHTAG
CVTYVTGEGDDQPSPRMAFTGDALLIRACGRTDFQGGSSDELYESVHSQIFTLPKDTLLY
PGHDYKGFTVSTVEEEVAYNARLTKDKETFKKIMDNLNLAYPKMIDVAVPANLLCGIQDP
PPSKV*

5'UTR

chr01:27278176..27278182 (- strand) : 7 bp

CDS

chr01:27277903..27278175 (- strand) : 273 bp

chr01:27277072..27277200 (- strand) : 129 bp

chr01:27276848..27276955 (- strand) : 108 bp

chr01:27275908..27276042 (- strand) : 135 bp

chr01:27275651..27275692 (- strand) : 42 bp

chr01:27275430..27275489 (- strand) : 60 bp

chr01:27275310..27275363 (- strand) : 54 bp

chr01:27275196..27275220 (- strand) : 25 bp

chr01:27274932..27275023 (- strand) : 92 bp

3'UTR

chr01:27274750..27274931 (- strand) : 182 bp

FASTA

>Os01t0667200-02 class=Sequence position=chr01:27274750..27278182 (- strand)
GAGCCAAATG GTGGCGCTGC TTCGCTCGTG CCGCCGCCTG ATCCCGCACC TGTCCGCCTG CGCCGCCGCC GCGCCGTCGT
CGTCATCGTC GTGCGCTCCT CGGGCTAGGC CGATCTCGCG GGGACTGCGG CTGCTGCCGG TGGTGCTCGC AATGGCGGGG
TACAGCAGCG GCTCCGCCGC GGAGGGGAGG AGGCTGCTGT TCAGGCAGCT GTTCGAGAAG GAGAGCTCCA CCTACACCTA
CCTCCTCGCC GACGTCGGGG ACCCCGAGAA ACCCGCCGTG GTGAGTAGTT GATGCTCTTG ACCATCTGTT CGTTGTTCTG
GGTATCAGTT GGGTAAATGG AAGCCTCTTT TATGGATACC GTAAGCAGGA TTACTCTTTC AGTGGCTACT GCAGAAATGT
AGATACCAAC ATAAATTAAA TAGCAAACTA AATACTCCAA ATAGGTATAA GACTGGAATA ATTGATTATT ACCTGTGAAT
TGTGGTATCC CTAACTAATT TAAAGATCAT CTTGCGTTTT TTTAATGTCT GACAGTACGC AAGATATTGG CAATGTTGCA
ATCAGTGACG GTGATTATAA TTATCCAGTT CAGGAGGTGC ATTTATAAAC TATGAAAGAT AATCAAATTA CTTGATATCA
TTCTGATGGG TTACATATAT TCATGTTATC TTGGACTTGG CACTACATTA CATAAATGCG CAATCTCGCT AATTTGTTCA
AGAATCCCAA AACTTAACCT TCTCCACGGT TTTGCTTAAG TATTTTCAAA TAATTTGTTT TCTTAATTAT CGTATTGATT
GAGCCAAAAT GAAAAAAAAT GTAACCTTTT TCTCTATATA TGTGACAGAC TAGACTAGCG CAATAAGCAC TAAACTAAAT
CAGAAAAAAA TATTGATGCT GTTTTTGTAG ATTTGATGTT TAGCTATAGT TGCTTCCATT TTGTTGATCA CCTCCCTAAT
GTCCTTGGTT TTGTGTTATC AGTTGATTGA CCCTGTGGAC AGAACAGTTG ATAGAGATCT CAATCTTATC AAGGAGTTGG
GCTTGAAGCT AGTCTATGCT ATGAATACCC ATGTGCATGC TGATCATGTC ACTGGAACAG GATTAATAAA GGTAAATAGT
TCCAACCTCT GAACTTCTCG AGATCTTGTG ATATGTTTTC TTTTCATAGT CTTGATACTT TGTTCTCTTT GGTCATAACA
TGGTCATCTG ATGGAATGTA CTTGCAGACT AAGTTACCTG GAGTAAAGTC CGTGATTGCA AAAGTAAGCA AAGCAAAAGC
AGACCATTTT ATTGAGCATG GGGACAAAAT ATACTTCGGT AACCTCTTCC TTGAGGTATA ATCCCATTTT AATTAGCTGT
TTGGCTATGT GTTTCTTCTT TCATTTAGTA AGCACTGACA TAATTTATGG GGACTATTGA AACTAGTCCT TTTGAGCTCT
CTGGCTGAAC TTAATAAACA TTAATCCTGA ACTCTCAACC ACCCCACCCC CACCCCTCTG AATTTTATGG AGTATGGCAA
TTGCAGCAGT TCCCCTAGAA TCTCACTCTA TACAGGCTGC AAATATGAAC GGATTGTCTA CTTCTAATTA TAAAAGGGCT
TTTTCTGTAT ATGGTCATCT GAGTGGTCTG TTTGTGGTGG TGGTGGTCAG AGACATAATT TATGTGATCT ATTCATATAT
GTATATTTTG TTTCCTTAAT CATTTTAACT TTGCGGTGTT TGTCAGTAAG ACGATAAACA GTTGTCCACA CAGCTAATTC
AGGACTTAAA AACTGTGCAC TTTTGTAGGT TAGACTTGTA TAACAAATTT AAAAGTATTT TCCCTTGGTT CATACAAAAT
GAGGTAATGT GAATGTTTAT GGAGATATGG TGTTTGGGTG ATATTAAATA TTTTCTCAGC TGTGCAACCA TTGTTTGTGG
ATATGTTGAT TCTTGAAATT TGTGTTCTTA TTGAAAGTTT GGCTTTAGGT ATTTATAGCA TATCCATGAC AGATATAATA
TGAATAAGAA AACGTATACT GTCAACCAAG CTGCTGAATA AAACAGCATT GAAAATTATG CATCTTTGTT CTATCCGTCA
TGTAATATTT TGGATATGAT GAAATTTTCT GATATCAGAA ATGGCAAAAT TGCTTTTTAG GTACGATCTA CTCCTGGCCA
TACTGCTGGC TGTGTGACTT ATGTAACAGG TGAAGGCGAT GATCAACCTT CACCAAGAAT GGCTTTTACT GGTGATGCCT
TGCTTATACG TGCATGTGGA AGGACAGACT TTCAGGTAAT TGTTACCACT GCCACTTCTT AATGGCTTAG CGATCAGGAA
CTGTTCTGTT TGAAATCTAA AGATACCGTG GTTAATTAAA TTAATAGGGA CTGAATGTAT TCTGTCTGTT AGTCAAGCAT
AAGTTTGCTT GCATACGGAA GCTCAGAATT CATGTTCTAG AGAAATTCTG TTTAAACATA GATTGTTTAT TTTGTTTTCT
GGTATTACAG GGAGGAAGTT CTGATGAGCT GTATGAGTCG GTGCATTCGC AGGCAAGTAT GCATTATCCT TTTTTTAAGA
CTAAATACAC ATCAGCTTAT AGAATAGCAT ACCACTTTTT TTAGGCAATC ATACATAATA TTTTGAAACT AGGCACACAT
CATCTTCATA CATAATATGA AGGGTAGGTA GCTGACTTTT TTATCCTTAT CAGATTTTCA CATTGCCAAA GGATACCCTG
CTTTATCCTG GCCATGACTA CAAAGGTTTC ACAGTAAGTG CTCACTTTCT TAAAGCTCAC TAATCAAGGT ACCAGGCACT
TGACTATTTT ATTTTGCAGG TAAGTACTGT TGAAGAGGAG GTTGCGTATA ATGCTCGACT AACAAAGGAT AAGGTACATG
CTACTTTGGC TAATTCTTTA CACCCATCTA ACTAATAAAA GCTATATTTT TTCTGATATT AATTTACTTG TTATGTTTAT
AGGAAACATT CAAGAAAATT ATGGACAGTA AGTTTCAGAG TCTTTAACAA TGGATATGTG CCTTTTCTTC TCGCATCAAT
TTATGAATAT CCATTTTCAT TATACTTCTG CTCACGTAGG CACTTACCAG ATCAAATCTT ACCTCCACTT TTTTAATACA
CTAAACAAGA TCTGGATCGT TTACTCTGTC CACTTGCAGA CTTGAACTTG GCCTATCCAA AGATGATCGA TGTAGCCGTG
CCCGCGAATT TGCTCTGCGG TATTCAGGAT CCTCCACCAT CCAAGGTCTG AGCTGTTCCG GCTGAAGCTT TCAAGCTGTT
GTGAACTCAC GGTCAACTCG AGAAGCTCGC AGCTATGTTG TACATTAAAT AATCTGTTGT TAATTTGTAA GGCACTACTT
GGGAACATTT CCGCTTCATG AGATCAACGG TAATAATAAT AAACAGAGGC TAGCTTGCCT CTTGTCTTGT GCT

Locus: Os01g0667200

Loading...

Locus: Os01g0667200

Loading...