Os01t0670800-01

Locus

Os01g0670800

Description

Similar to Auxin response factor 2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsARF2, ARF2, OsETT2, ETT2, ARF3a, DLN16, OsDLN16

Oryzabase Gene Name Synonym(s)

auxin response factor-2, auxin response factor 2, OsETTIN2, ETTIN 2, DLN repressor 16, DLN motif protein 16, ARF2-LIKE

Transcript Evidence

AK103776 (DDBJ, Best hit)

Protein Evidence

Q0JKI9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Biological Process: response to hormone stimulus (GO:0009725)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

Transcriptional factor B3 (IPR003340)

Auxin response factor (IPR010525)

DNA-binding pseudobarrel domain (IPR015300)

Full-length cDNA

J033143P19 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0670800-01)

RiceXPro (AK103776)

Others

Oryzabase (9996)

KEGG (Os01t0670800-01)

Transcript

2337 bp

>Os01t0670800-01 Similar to Auxin response factor 2.
GTGCTGTTTGCAGGCGGACGCCGCGACGGACGAGGTGTACGCGCAGGTCTCGTTGGTCGC
CGACAACGAGGAAGTGGAGAGGCGGATGCGGGAGGGAGAGGACGGCGCGGCCTGCGACGG
CGAGGGCGAGGACGCCGTGAAGCGGCCGGCCCGGATTCCCCACATGTTCTGCAAGACGCT
CACGGCCTCCGACACCAGCACGCACGGCGGCTTCTCCGTGCCTCGCCGCGCCGCCGAGGA
CTGCTTCCCGCCGCTGGACTACAGCCTGCAGAGGCCATTCCAGGAGCTCGTGGCAAAGGA
TCTGCACGGCACGGAATGGAGGTTCAGACATATCTATCGAGGCCAACCACGGAGGCACCT
TTTAACCACTGGATGGAGCGGGTTTATCAACAAGAAGAAGCTAGTATCTGGGGATGCAGT
GCTATTCCTCAGAGGTGAAGATGGAGAGCTTCGATTGGGAGTGCGCCGAGCTGCTCAGCT
AAAAAATGCATCTCCTTTTCCTGCACTTCATAACCAGATCTCAAATACTAGTAGTCTTAG
TGAAGTTGCACATGCTGTGGCCGTGAAAAGTATTTTTCACATCTACTACAATCCCAGTTG
TACTCACAGGTTAAGTCAGTCTGAGTTCATTATACCATATTGGAAGTTTATGAGAAGCTT
CAGTCAACCCTTTTCTGTTGGAATGCGATTCAAATTGAGATATGAGAGTGAGGATGCTTC
TGAAAGAAGGCGTACTGGAATAATAATTGGAAGCAGAGAGGCAGATCCAATGTGGCATGG
TTCGAAGTGGAAATGTTTAGTGGTGAAATGGGATGATGATGTGGAGTGCCGTCGGCCTAA
TGGGGTATCTCCTTGGGAGATTGAGCTTAGTGGATCAGTTTCAGGATCTCATCTGTCCAC
TCCCCATTCAAAACGGCTGAAATCATGCTTCCCCCAAGTTAATCCAGATATTGTGCTTCC
AAATGGAAGTGTTTCTTCAGATTTTGCGGAGTCTGCCAGATTCCACAAGGTCTTGCAAGG
TCAAGAATTGTTGGGTTTAAAAACTCGTGATGGTACTGTTAATACAGCTTCTCAGGCGAC
TGAGGCAAGAAATTTTCAGTACACTGATGAACGAAGTTGCTCTATCAACATGAGTAACAA
TATCTTAGGGGTTCCGAGACTTGGGGTGAAAACTCCAAGTGGAAACCCTGGGTTTTCCTA
CCATTGCTCAGGCTTTGGGGAATCTCAAAGATTCCAAGAGGTCTTGCAAGGTCAAGAAGT
GTTTCGTCCTTACCGAGGAGGGACTTTGTCCGATGCCTGTATAAGAGGTTCTGGCTTCCG
TCAACCTGATGGCAACCATGCACCTGGTGCAGCATTTAAATGGCTTGCACCACAAGGATG
TGATCATCATGGGATAACCACATCAGTTCTGCCGCAAGCATCCTCTCCATCATCTGTCTT
AATGTTTCCACAAACTAGTTCAAAGATGCCTGGCCTTGAATACATATACGGATGCCTGGA
TAGAAATGAGAATAGCCGACATTTTAAGATTGGACCTACACAAGATATGACAAGAACTGA
TCAAACATTACGACTCTGGCCTCATCTTATTTCAGGCAAAGTGCTAGATGAGTGTACGAG
AAATGAGAAGCTGCACTCTCCAGTCAGTGGTGCTGAGCATGAATCAAATAACAAGTGTCT
TAATACAAATGGCTGCAAAATCTTTGGTATATCATTGACTGAAAAGGCCCAAGCAGGCGA
TGAAGTGGATTGTGGCAATGCCAGTTATCATTCTCGGCTCCAGTCTTTAAAACCACAGAT
GCCAAAATCATTGGGCAGCAGTTGTGCCACGGTCCATGAACAAAGGCCTGTTGTTGGCAG
GGTCGTTGATATTTCAGCAGTGAATACGATGATCTGATACATTTACTGTATCCAGGGAGT
ATGCTTGCAGAAATAGGGACCAACATTAGTATCATACTCACTGGTGCTGAGGACACAACT
TCCATTCTGGCTATCTCGTCCCTCTACGTGCTTGTTGCCTCAACTTCAGCATTTCCACAG
GCTGTGCTACCGCATCCAGGATGATGACAGGGGAAATGCAGATGATACACGAAGGATGCT
TGTCAAGTTTGTTGTAATGCACTTCTAAGTTCTAAGCTTTGAACCTCTTAACGTTGCTCC
TATTTTAAGCTCCCGTTGTAATCGGCATTTATGTTGCCTGACCTACTTGCATATTTTTCA
ATTTGTCCGTTAAGACAGCCCTTTTAGAGGGCTTGCTTATGTTAGCAACCCTTAATTTCC
AAATTCCAAGTATGGCGACCGTTCGAGGGGTTTGTTTGCTCCTGGGACGACATCGGT

CDS

1896 bp

>Os01t0670800-01 Similar to Auxin response factor 2.
TGCTGTTTGCAGGCGGACGCCGCGACGGACGAGGTGTACGCGCAGGTCTCGTTGGTCGCC
GACAACGAGGAAGTGGAGAGGCGGATGCGGGAGGGAGAGGACGGCGCGGCCTGCGACGGC
GAGGGCGAGGACGCCGTGAAGCGGCCGGCCCGGATTCCCCACATGTTCTGCAAGACGCTC
ACGGCCTCCGACACCAGCACGCACGGCGGCTTCTCCGTGCCTCGCCGCGCCGCCGAGGAC
TGCTTCCCGCCGCTGGACTACAGCCTGCAGAGGCCATTCCAGGAGCTCGTGGCAAAGGAT
CTGCACGGCACGGAATGGAGGTTCAGACATATCTATCGAGGCCAACCACGGAGGCACCTT
TTAACCACTGGATGGAGCGGGTTTATCAACAAGAAGAAGCTAGTATCTGGGGATGCAGTG
CTATTCCTCAGAGGTGAAGATGGAGAGCTTCGATTGGGAGTGCGCCGAGCTGCTCAGCTA
AAAAATGCATCTCCTTTTCCTGCACTTCATAACCAGATCTCAAATACTAGTAGTCTTAGT
GAAGTTGCACATGCTGTGGCCGTGAAAAGTATTTTTCACATCTACTACAATCCCAGTTGT
ACTCACAGGTTAAGTCAGTCTGAGTTCATTATACCATATTGGAAGTTTATGAGAAGCTTC
AGTCAACCCTTTTCTGTTGGAATGCGATTCAAATTGAGATATGAGAGTGAGGATGCTTCT
GAAAGAAGGCGTACTGGAATAATAATTGGAAGCAGAGAGGCAGATCCAATGTGGCATGGT
TCGAAGTGGAAATGTTTAGTGGTGAAATGGGATGATGATGTGGAGTGCCGTCGGCCTAAT
GGGGTATCTCCTTGGGAGATTGAGCTTAGTGGATCAGTTTCAGGATCTCATCTGTCCACT
CCCCATTCAAAACGGCTGAAATCATGCTTCCCCCAAGTTAATCCAGATATTGTGCTTCCA
AATGGAAGTGTTTCTTCAGATTTTGCGGAGTCTGCCAGATTCCACAAGGTCTTGCAAGGT
CAAGAATTGTTGGGTTTAAAAACTCGTGATGGTACTGTTAATACAGCTTCTCAGGCGACT
GAGGCAAGAAATTTTCAGTACACTGATGAACGAAGTTGCTCTATCAACATGAGTAACAAT
ATCTTAGGGGTTCCGAGACTTGGGGTGAAAACTCCAAGTGGAAACCCTGGGTTTTCCTAC
CATTGCTCAGGCTTTGGGGAATCTCAAAGATTCCAAGAGGTCTTGCAAGGTCAAGAAGTG
TTTCGTCCTTACCGAGGAGGGACTTTGTCCGATGCCTGTATAAGAGGTTCTGGCTTCCGT
CAACCTGATGGCAACCATGCACCTGGTGCAGCATTTAAATGGCTTGCACCACAAGGATGT
GATCATCATGGGATAACCACATCAGTTCTGCCGCAAGCATCCTCTCCATCATCTGTCTTA
ATGTTTCCACAAACTAGTTCAAAGATGCCTGGCCTTGAATACATATACGGATGCCTGGAT
AGAAATGAGAATAGCCGACATTTTAAGATTGGACCTACACAAGATATGACAAGAACTGAT
CAAACATTACGACTCTGGCCTCATCTTATTTCAGGCAAAGTGCTAGATGAGTGTACGAGA
AATGAGAAGCTGCACTCTCCAGTCAGTGGTGCTGAGCATGAATCAAATAACAAGTGTCTT
AATACAAATGGCTGCAAAATCTTTGGTATATCATTGACTGAAAAGGCCCAAGCAGGCGAT
GAAGTGGATTGTGGCAATGCCAGTTATCATTCTCGGCTCCAGTCTTTAAAACCACAGATG
CCAAAATCATTGGGCAGCAGTTGTGCCACGGTCCATGAACAAAGGCCTGTTGTTGGCAGG
GTCGTTGATATTTCAGCAGTGAATACGATGATCTGA

Protein

631 aa

>Os01t0670800-01 Similar to Auxin response factor 2.
CCLQADAATDEVYAQVSLVADNEEVERRMREGEDGAACDGEGEDAVKRPARIPHMFCKTL
TASDTSTHGGFSVPRRAAEDCFPPLDYSLQRPFQELVAKDLHGTEWRFRHIYRGQPRRHL
LTTGWSGFINKKKLVSGDAVLFLRGEDGELRLGVRRAAQLKNASPFPALHNQISNTSSLS
EVAHAVAVKSIFHIYYNPSCTHRLSQSEFIIPYWKFMRSFSQPFSVGMRFKLRYESEDAS
ERRRTGIIIGSREADPMWHGSKWKCLVVKWDDDVECRRPNGVSPWEIELSGSVSGSHLST
PHSKRLKSCFPQVNPDIVLPNGSVSSDFAESARFHKVLQGQELLGLKTRDGTVNTASQAT
EARNFQYTDERSCSINMSNNILGVPRLGVKTPSGNPGFSYHCSGFGESQRFQEVLQGQEV
FRPYRGGTLSDACIRGSGFRQPDGNHAPGAAFKWLAPQGCDHHGITTSVLPQASSPSSVL
MFPQTSSKMPGLEYIYGCLDRNENSRHFKIGPTQDMTRTDQTLRLWPHLISGKVLDECTR
NEKLHSPVSGAEHESNNKCLNTNGCKIFGISLTEKAQAGDEVDCGNASYHSRLQSLKPQM
PKSLGSSCATVHEQRPVVGRVVDISAVNTMI*

5'UTR

chr01:27506654..27506654 (- strand) : 1 bp

CDS

chr01:27506585..27506653 (- strand) : 69 bp

chr01:27506297..27506482 (- strand) : 186 bp

chr01:27506123..27506207 (- strand) : 85 bp

chr01:27505437..27505527 (- strand) : 91 bp

chr01:27505196..27505360 (- strand) : 165 bp

chr01:27504053..27504184 (- strand) : 132 bp

chr01:27503878..27503950 (- strand) : 73 bp

chr01:27503094..27503253 (- strand) : 160 bp

chr01:27502139..27503007 (- strand) : 869 bp

chr01:27502003..27502068 (- strand) : 66 bp

3'UTR

chr01:27501563..27502002 (- strand) : 440 bp

FASTA

>Os01t0670800-01 class=Sequence position=chr01:27501563..27506654 (- strand)
GTGCTGTTTG CAGGCGGACG CCGCGACGGA CGAGGTGTAC GCGCAGGTCT CGTTGGTCGC CGACAACGAG GTGCGTTTGC
GTGCGTGCTG ATCCAAAAAT GGGATGAATA TCTTTGACAT TCGGTCAGTG CTAGTAGCTC AAACGAACAT TATTTCTGGG
TGGTTTTTTC AGGAAGTGGA GAGGCGGATG CGGGAGGGAG AGGACGGCGC GGCCTGCGAC GGCGAGGGCG AGGACGCCGT
GAAGCGGCCG GCCCGGATTC CCCACATGTT CTGCAAGACG CTCACGGCCT CCGACACCAG CACGCACGGC GGCTTCTCCG
TGCCTCGCCG CGCCGCCGAG GACTGCTTCC CGCCGCTGGT ACGGGACGAT ATCGATTGGG ACAAGCTACC TCACCGTGAT
CTGTTTGATT GCTTGTGTGG TGACTCTGTT CAGCTTGGCG CCTGCAGGAC TACAGCCTGC AGAGGCCATT CCAGGAGCTC
GTGGCAAAGG ATCTGCACGG CACGGAATGG AGGTTCAGAC ATATCTATCG AGGTGATTCG CCGGTTTAGC CTATCTTGGT
GACTGGGATA TCAGCCGTAC TATCACTAAC TACCATATAT ATGTCATACA GCTTGGTTGT TAGGCTTCTC CCTGGGAACA
TGGGATTAAT TTTCTTAATG CGTGAGAGAA CCTAGTAACC TACGGGCTGT ACAGTCCTAC ATCTTCCTAT AGTACATCAC
AGGCTGTTTA GGTTGAACTA CTGTACTTTG TTCACCGAAT AACGCATTAG TATATATATG TTTTTTCTTT TAGTAAGATT
ATCCAGGTCT CCTTTTTAGA TACATCTATC ATGTCTAGGT ATTGGAAGCG AGATGGCTGT CCAGTTTAGA CGAAACAAGC
AAACCAAACT GTAACTTGGC TGGCTGGATG AGATAAAAAT GAGCAAACTA TGCTATTTTT TCTCATTAGG CTCTGCTCAC
TTACTCTGGG AGTGTTTTCA ATAAATTATT TTAATTTATG CATAGACTAC CTATTTCTAC AGCTATTGCG ACATAATCTC
TAATAGTTAA GCTAATTGCA ATTTGGAGGA GTCTTGAGAA AATTATGGTC CATGAATATC TCATAGGTCT GCCTCTAATT
GTTACAGGCC AACCACGGAG GCACCTTTTA ACCACTGGAT GGAGCGGGTT TATCAACAAG AAGAAGCTAG TATCTGGGGA
TGCAGTGCTA TTCCTCAGGT AGGCCTATAG CTCATGTGCT CATGAACCAC TAACTCGAAA TGTACTAAAG CTTCTCTTTT
GTAATGATCT CCAGAGGTGA AGATGGAGAG CTTCGATTGG GAGTGCGCCG AGCTGCTCAG CTAAAAAATG CATCTCCTTT
TCCTGCACTT CATAACCAGA TCTCAAATAC TAGTAGTCTT AGTGAAGTTG CACATGCTGT GGCCGTGAAA AGTATTTTTC
ACATCTACTA CAATCCCAGG TAATAAAGTA CTTTCCTGAT TTTTTGAATA TTTAAATACC TGTACCTGTA GATGTTATTT
GCACAAGTAA CCATCATAAA AATAAGTACA AGTCACAGAT GCACATAATA TTGCACATAC TGTACTTTTC CAACCAGTCA
AATAATCAAC CATATAATAA GAGGATGTCG GACAGACAGA CACAGCAATA GCTTGTGATA GAACAAGTTA TACATACCAT
ATGAGCTAGA GAATATTAAT ATTTATTCCT TGTTTCCTCA TGTCAAGTTC AAACTCCAGA TCATATAAGT TGGTGGCATG
TTTTCAGTCA TCCAGAAAAT TTCCAATGCT GACATTTTTC AAATGCTCAT TGTTTATATC ATGGAACTGG ACTTGTAATT
TTGTATTAGA ATTGCAACAT TGTAAAGTTT AGTTCCGGCT TTTTCTAATC CAACCTTTTG GTATGTGAAT AGTAGTTTCC
TGGCTGACTT TGCTGATCTC GACCATGTAG AATATTGTGT TGTTTTTACC ACATTTAATT TGCTGAATAT ATTTGTTTTC
TCGGATATAC TAAATGATGC CACATTGCCA TTGCATGTGT TCCTCGAAAG TGTTGAGGAA GTGCACATTG AAGCAGCAAT
ATGATTTAAG AGGATGTATC TAATTTTCTT GTTTTCAAAT GGTCATGTGT GGTTTACTGC TTTACTTTCA TGTGTGGTTT
AGCAATATAG ATTTCAGAGG ATGTATCTAA TTGTCACCAT TTTGCAATAA TCGAGCAATT TTAACAATGT TTTGTGCTAT
TTCTAAGATA CATCAGATAA AAAAAAGAAG GATAATTCAG TTCCATTGTA GTGATAATGG TCTTTCTTTC AAATGATATT
CATGCATTTG CAATGTGCAA CTTCTGACTG TTCTTCTGCA TGCTATGTCC TAATGTGGAT ATGGTTAAAA GTCTTCAGAG
TTACAGATTT TCTTTTTGTC TGCTTCTCTT GTTGGATAAT GTCTTGATGT CAGTTCCTGC CTTTAATAAG TTGTACTCAC
AGGTTAAGTC AGTCTGAGTT CATTATACCA TATTGGAAGT TTATGAGAAG CTTCAGTCAA CCCTTTTCTG TTGGAATGCG
ATTCAAATTG AGATATGAGA GTGAGGATGC TTCTGAAAGA AGGTATTATC CAACAGTTAT ATTTCATGTT TTGCGAAATG
GCATTACAAT GGTAAAGATA TTTCTAGCTC GTGCTTGGTT TTTCATAAAG AATTTGTTTT TCAGGCGTAC TGGAATAATA
ATTGGAAGCA GAGAGGCAGA TCCAATGTGG CATGGTTCGA AGTGGAAATG TTTAGTGGTA TGCGCTCTTA TATATAATAC
TGCTTTGCAC AGATGGATGC CAGTAGTTCT CTTATTTGAT GTTTTACTGC CTAGTGGGTC CGTGTCTTTC AAATAGCAGA
GTGCTTCTCT GTATTCAGCA TTCAACATTT TGTGTTCCAT GTCTTAGCTT TTTATCTGTT GGGAAGTTAT AGTTTGTACA
ATCCAAAATT TTGAATAGAT TTAATGGCTC ATACAAGGGT AAATTACGGA AACAAAGGCA TTTAACCTTT TTATGTGAAA
TAAACTAGCT TAAAGTTTAT TTTTGTGAAC TTATGAAAGT ATTGGTCAAG ATTTCAGTGT TTGCAGCGCA TATGTAAATT
CGTGTTTGCA GCGCATATGT AAATTCTTGG TGTACTTCAG GTTCTATATC TATGTTTTTC TGAACACACA AGTTTAGAAG
CATTTGATAT GATGAACCCT GAAAAATAGC GCCCTGCACT TCTGCTTATC AGCTTATAGG ATAGAATATA GAGGTTGAAG
GGCATACTTT ACATGCCATA GTGGGCAGGG CATCGTCTTT ACTTTGTTAA AATTTTCTCC ATTTATATTC CAAATCTTTA
TCATGTTCCT GATTTCTAGT ATTGTATTGT GATGGTGACA GGTGAAATGG GATGATGATG TGGAGTGCCG TCGGCCTAAT
GGGGTATCTC CTTGGGAGAT TGAGCTTAGT GGATCAGTTT CAGGATCTCA TCTGTCCACT CCCCATTCAA AACGGCTGAA
ATCATGCTTC CCCCAAGTTA ATCCAGATAT TGTGCTTCCA AGTAGGTTCC ATTTACAAGT CAAAGGAATC ATTTTCTGTG
CTGCATGTTC CCTGTTGAAC TCACTTTTCC TTTTCCCATT TTGGCAGATG GAAGTGTTTC TTCAGATTTT GCGGAGTCTG
CCAGATTCCA CAAGGTCTTG CAAGGTCAAG AATTGTTGGG TTTAAAAACT CGTGATGGTA CTGTTAATAC AGCTTCTCAG
GCGACTGAGG CAAGAAATTT TCAGTACACT GATGAACGAA GTTGCTCTAT CAACATGAGT AACAATATCT TAGGGGTTCC
GAGACTTGGG GTGAAAACTC CAAGTGGAAA CCCTGGGTTT TCCTACCATT GCTCAGGCTT TGGGGAATCT CAAAGATTCC
AAGAGGTCTT GCAAGGTCAA GAAGTGTTTC GTCCTTACCG AGGAGGGACT TTGTCCGATG CCTGTATAAG AGGTTCTGGC
TTCCGTCAAC CTGATGGCAA CCATGCACCT GGTGCAGCAT TTAAATGGCT TGCACCACAA GGATGTGATC ATCATGGGAT
AACCACATCA GTTCTGCCGC AAGCATCCTC TCCATCATCT GTCTTAATGT TTCCACAAAC TAGTTCAAAG ATGCCTGGCC
TTGAATACAT ATACGGATGC CTGGATAGAA ATGAGAATAG CCGACATTTT AAGATTGGAC CTACACAAGA TATGACAAGA
ACTGATCAAA CATTACGACT CTGGCCTCAT CTTATTTCAG GCAAAGTGCT AGATGAGTGT ACGAGAAATG AGAAGCTGCA
CTCTCCAGTC AGTGGTGCTG AGCATGAATC AAATAACAAG TGTCTTAATA CAAATGGCTG CAAAATCTTT GGTATATCAT
TGACTGAAAA GGCCCAAGCA GGCGATGAAG TGGATTGTGG CAATGCCAGT TATCATTCTC GGCTCCAGTC TTTAAAACCA
CAGATGCCAA AATCATTGGG CAGCAGTTGT GCCACGGTAA GTGCTCAATG AAATGTTCTT TTGGCATCTT CTTCCTGAAA
TTGCTTGCTA ACCGAATTAT TTACAGGTCC ATGAACAAAG GCCTGTTGTT GGCAGGGTCG TTGATATTTC AGCAGTGAAT
ACGATGATCT GATACATTTA CTGTATCCAG GGAGTATGCT TGCAGAAATA GGGACCAACA TTAGTATCAT ACTCACTGGT
GCTGAGGACA CAACTTCCAT TCTGGCTATC TCGTCCCTCT ACGTGCTTGT TGCCTCAACT TCAGCATTTC CACAGGCTGT
GCTACCGCAT CCAGGATGAT GACAGGGGAA ATGCAGATGA TACACGAAGG ATGCTTGTCA AGTTTGTTGT AATGCACTTC
TAAGTTCTAA GCTTTGAACC TCTTAACGTT GCTCCTATTT TAAGCTCCCG TTGTAATCGG CATTTATGTT GCCTGACCTA
CTTGCATATT TTTCAATTTG TCCGTTAAGA CAGCCCTTTT AGAGGGCTTG CTTATGTTAG CAACCCTTAA TTTCCAAATT
CCAAGTATGG CGACCGTTCG AGGGGTTTGT TTGCTCCTGG GACGACATCG GT

Locus: Os01g0670800

Loading...

Locus: Os01g0670800

Loading...