Os01t0672100-02

Locus

Os01g0672100

Description

No apical meristem (NAM) protein domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC73

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 73

Oryzabase Gene Symbol Synonym(s)

ONAC073, ONAC73, OsSND2, SND2

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 073, NAC domain-containing protein 73, SECONDARY WALL-ASSOCIATED NAC PROTEIN2

Transcript Evidence

AK102794 (DDBJ, Best hit)

AK060307 (DDBJ, Best hit)

Protein Evidence

NP_001148826.1 (RefSeq)

Literature

Note

Manual Curation

Full-length cDNA

J033108B03 (Online Clone Ordering)

001-007-A11 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0672100-02)

RiceXPro (AK102794)

Others

Oryzabase (11497)

KEGG (Os01t0672100-02)

Transcript

1515 bp

>Os01t0672100-02 No apical meristem (NAM) protein domain containing protein.
GTTCCCTCCTCTCCTCCTTTCTCTCTCCCTCCTCCCGCGCGCGGGGTCTCGCCTTAACGT
TTGCCGCATATGGGGGCGACGAGCAAAGCGTAGGCCGGAGGGAGGGACAGGGAGAGAGAG
AGAGAGAGGCTTTCTGGCTCGCTCTCTCTGCACGATCTCTCGTCTTGTTGGATTATACAG
CCATGACATGGTGCAACAGCTTCAACGACGTGCGCGCCGTGGAGAACAACCTGGCCACCG
CCGCCGCCGTGGCCGCGGCCAAGAAGCAGCAGCAGCAGCAGCAGGTCTCCCAGCACGTCA
ACCTCATCAAGACCTGCCCCTCCTGCGGCCACCGCGCGCAGTATGAGCAGGCAGCGGCGG
CGGCGACGATCCAGGACCTGCCGGGGCTGCCGGCCGGGGTGAAGTTCGACCCGACGGACC
AGGAGCTGCTGGAGCACCTGGAAGGGAAGGCGAGGCCTGACGCGCGGAAGCTCCACCCCC
TCATCGACGAGTTCATCCCCACCATCGAGGGCGAGAACGGCATCTGCTACACCCATCCCG
AGAGGCTTCCAGGCACTCGGCAAGGACGGCCTGATCCGGCACTTCTTCCACCGCCCGTCG
AAGGCGTACACGACGGGGACGCGGAAGCGGCGGAAGGTGCACACCGACGAGCAGGGCGGC
GAGACGCGGTGGCACAAGACCGGCAAGACGCGGCCGGTGTTCACCGGCGGCAAGCTGAAG
GGGTACAAGAAGATCCTGGTGCTCTACACCAACTACGGCAAGCAGCGCAAGCCGGAGAAG
ACCAACTGGGTGATGCACCAGTACCACCTGGGCTCCGACGAGGAGGAGAAGGACGGCGAG
CTCGTCGTGTCCAAGGTGTTCTACCAGACGCAGCCGAGGCAGTGCGGCGGCGGCTCGGCA
GCGACGGCCAAGGACCTCTCCGTCGACCTCGTCGCCGGTAACAACATCAAGGCTAGCAAT
GCTGCTGCTGAACACCACCATAACGACGGCGTCGGCGGCGGCGGCCACGGTGGCAACAAC
AGCAGCATGCTGAAGGAAGCTGCAGGCATTGTAGATTTCTACAACCCAGCGGCGGCGCTA
ATCGGCTACAGCCAGGCGGCTCCTAACAACAGGGCGGCTGCTTCTGCTCATTTGACGATG
CCTAACTTTGAGGTGCACACAGGAGGTGCAGGCTTTGGCCCCTGATGGATGGAAGAAAAC
AAAGCAAATTAAACATATTTGACTGATGATATATATAGGTTAGATGGAGAGGGCAGGGCA
GGTATATGATGGCAAATGTGCATCATGCATGCTAGCATGGTGTAATTTGCATCGAGTGAA
AAAAAAGGAGTTTACTAAACCGTCTACGTACGTATTACTGGACAATAAGGAGTGTGTCGA
GTGAGTTGCTGCACAGATGTTGAAGCGTAGGGGGGTCGATATTCTTACAGTGTTCATTAT
TGTTACATGTGTACACATATATAACTTGACATTCTCAATTTTTTTGTTTAATGATATATA
TATATATATATATAT

CDS

759 bp

>Os01t0672100-02 No apical meristem (NAM) protein domain containing protein.
ATGACATGGTGCAACAGCTTCAACGACGTGCGCGCCGTGGAGAACAACCTGGCCACCGCC
GCCGCCGTGGCCGCGGCCAAGAAGCAGCAGCAGCAGCAGCAGGTCTCCCAGCACGTCAAC
CTCATCAAGACCTGCCCCTCCTGCGGCCACCGCGCGCAGTATGAGCAGGCAGCGGCGGCG
GCGACGATCCAGGACCTGCCGGGGCTGCCGGCCGGGGTGAAGTTCGACCCGACGGACCAG
GAGCTGCTGGAGCACCTGGAAGGGAAGGCGAGGCCTGACGCGCGGAAGCTCCACCCCCTC
ATCGACGAGTTCATCCCCACCATCGAGGGCGAGAACGGCATCTGCTACACCCATCCCGAG
AGGCTTCCAGGCACTCGGCAAGGACGGCCTGATCCGGCACTTCTTCCACCGCCCGTCGAA
GGCGTACACGACGGGGACGCGGAAGCGGCGGAAGGTGCACACCGACGAGCAGGGCGGCGA
GACGCGGTGGCACAAGACCGGCAAGACGCGGCCGGTGTTCACCGGCGGCAAGCTGAAGGG
GTACAAGAAGATCCTGGTGCTCTACACCAACTACGGCAAGCAGCGCAAGCCGGAGAAGAC
CAACTGGGTGATGCACCAGTACCACCTGGGCTCCGACGAGGAGGAGAAGGACGGCGAGCT
CGTCGTGTCCAAGGTGTTCTACCAGACGCAGCCGAGGCAGTGCGGCGGCGGCTCGGCAGC
GACGGCCAAGGACCTCTCCGTCGACCTCGTCGCCGGTAA

Protein

253 aa

>Os01t0672100-02 No apical meristem (NAM) protein domain containing protein.
MTWCNSFNDVRAVENNLATAAAVAAAKKQQQQQQVSQHVNLIKTCPSCGHRAQYEQAAAA
ATIQDLPGLPAGVKFDPTDQELLEHLEGKARPDARKLHPLIDEFIPTIEGENGICYTHPE
RLPGTRQGRPDPALLPPPVEGVHDGDAEAAEGAHRRAGRRDAVAQDRQDAAGVHRRQAEG
VQEDPGALHQLRQAAQAGEDQLGDAPVPPGLRRGGEGRRARRVQGVLPDAAEAVRRRLGS
DGQGPLRRPRRR*

5'UTR

chr01:27560500..27560681 (- strand) : 182 bp

CDS

chr01:27560332..27560499 (- strand) : 168 bp

chr01:27560032..27560237 (- strand) : 206 bp

chr01:27556601..27556985 (- strand) : 385 bp

3'UTR

chr01:27556027..27556600 (- strand) : 574 bp

FASTA

>Os01t0672100-02 class=Sequence position=chr01:27556027..27560681 (- strand)
GTTCCCTCCT CTCCTCCTTT CTCTCTCCCT CCTCCCGCGC GCGGGGTCTC GCCTTAACGT TTGCCGCATA TGGGGGCGAC
GAGCAAAGCG TAGGCCGGAG GGAGGGACAG GGAGAGAGAG AGAGAGAGGC TTTCTGGCTC GCTCTCTCTG CACGATCTCT
CGTCTTGTTG GATTATACAG CCATGACATG GTGCAACAGC TTCAACGACG TGCGCGCCGT GGAGAACAAC CTGGCCACCG
CCGCCGCCGT GGCCGCGGCC AAGAAGCAGC AGCAGCAGCA GCAGGTCTCC CAGCACGTCA ACCTCATCAA GACCTGCCCC
TCCTGCGGCC ACCGCGCGCA GTATGAGCAG GTAGCTAGCT AGAGCTTCCT CCCTGCTCGA TCGATCGATC GGTCTCCTGT
GTACATGTTG GATGGCATTG AGCATGGTGT AGAGTCAGTT GCAGGCAGCG GCGGCGGCGA CGATCCAGGA CCTGCCGGGG
CTGCCGGCCG GGGTGAAGTT CGACCCGACG GACCAGGAGC TGCTGGAGCA CCTGGAAGGG AAGGCGAGGC CTGACGCGCG
GAAGCTCCAC CCCCTCATCG ACGAGTTCAT CCCCACCATC GAGGGCGAGA ACGGCATCTG CTACACCCAT CCCGAGAGGC
TTCCAGGCAC GTATAATATA CTTACATGCA TGCTTTTCCT ACGACTCATC GACATATATC GAATCAGTTT TAGTTTCATC
AGTTCATGAT CTACATAAGT GCATTTGTCT CGATCAGCTA GCTTGCATGC TTAATTACAT TGTGCCATCA GCTATAGCAA
TTGCAAAGAT GATCAGATCT GGACGGGACG TGGAAACTAT AGGTGCTGTC CGTCACGGAA GTACTCCTGA CAAAACATTT
TCTTGCTTGG TTGATTCTCA GTTTAAAATT CCCTATTTTG ATATAAAGTT TTACTGGTCG TTTCCAATTT GATGACCTTG
CTTCATATAT GTCAATCATG CGTAGCCGCT TAGTATTTGT AACATCCACA CTAGGGTATA TACATGTCGA TCGTCCTTGC
GTTTTTCATT AATTTCGTGT ATGTCCGATC GTGTGTTGTT GCATTTGAGC ACGATACCGT ATAAATATTG CTAAAGTTTG
CCTTTGAAGT AATTGCTTCT CCTACTTGCA TAAAAGTTTA TTTCACATTG AAAACGAGTG ATTGTGACAG CACAGTGCAT
CAAAGGTCCA CGTCATGCAG GATACACGCA ACATCAGATC AAAGGGAGAA TAAACTTTGA AAAGACTTGT TGCAATATGA
ACTGGTTTTT CCCTTATCCT TTTATATTCC TAGTATTTAA TTTGCCTATA TATAATGGTG TATTTGCATG GGTAGGATAG
TCATTGTATA TTTGTGCAAT Aaggctatgt ttagtttgtg tgccaaattt tttttgaact atacggacac acatttaaag
tattaacgaa gactaataac aaaacaaatt acatttgaag tattaacgaa gactaataac aaaacaaatt acagattccg
tctataaact gcgagacaat tttattaagc ctaattaatt cattattagc aaatgtttac tgtagcatca cattgttaaa
tcatggcata attaggctca aaagattcgt ctcgttattt acatgcaaac tgtgaattgg ttttttttca tccacattta
atgctacatg gatgtgtcta aacatttgat gtgacggaaa agttggaagt ttaaaGAAAA ATTTTTGAAT CTAAACATGG
CCTAAGAATA ACTGACAGAT ACTTTAAATT ATTATGAGTG CCTTTCCTGC TTTTGGAAAT ATAATATTAT ATTCTTCAGG
GGGGTTGCAT TCCATTCCAC AGGATAACTT GTACTATTTT CTACCATAGT GATAGAAATA TTGCACCAAG AGACATTATA
GTGCACTGAT CATATTATTT TCATGGAACT CTATTTTCAT ATAAGCAGTT ATCAATAATA AACCACGTGT CACCATTGTA
CTATATATTA ATCCAGTAGA AAATGATATA TTACAAATAC TTTTATCTAG CAAGAATTAA TTATGATTAA AAAACCAATG
CAAGTGGCTC TTTATGTCGT TTACAACGCA AACATTTTTT TTCTTTGTTG GTGCTGGAGC TAGCGGCCGT TCGTGGGGTA
TTCTCATGGG AATATTGGTG TGGTAGTCTG TTAGACATAT GCGTGTTGAG CTGGAAAACA ATGTGCATGC AGGGGATGCT
CCTTCCATGG TACAAAGTAA TTTTCTTTAC ATTTCATAGA TTACAGCTGA CCTAAATTAA TTCTATCTGT AAGAAAATAA
TTAAGCCGAC AAATAAAAAT GTGTTATTTA GTTCCGCACA CTATTTTCAG GCCATATATA CATTTTATTT ATATTACACC
AAATTTACCT AGATTCAGTG GCTGAGCCAA GATCAAGATC CACCTCGCGC GAAATGCAAA TATTTTTTTT ACTAATAGTA
CTTGATTGCA AAAATTCTAT CGGGGTTAAT TGACCTTACA GGGTCACAGC ATGGCTCCAC TACTATCTAC ATTATATTAT
AAGTACTCCA TAATGTGGAT AAGGATTTTC TGAAGTTTAT CGGTGAGTAA TTCTTTAAAT TCAAAGATAG TTTCACCCTT
CAGCGCCATA TCTCCACTAA ACCACTTTAA ATTCAGTCCG TTGTATAAAA AGTAATCTAT TTTTGATAGT TTATGGTTAA
ATAATGTATG AAGATTCTAG GATTGTCTAT CACACTTTTA TAAAAGTTTA AGGTTGTAGT TAACATGCAT AATCTTTTCC
TTTTTTTACA ACCTGGGAAA TTTCATTTCT ATGTTAAGAG ATGCAAAACA CAAATACGCC CCCACCTCCT CTTTAAATAT
AATTTTATTC GGTGAAACTT TAAAGTTTAA CCATCAACAT CTCTCAAATA TGTATTTAAT TTGAAAATAA AAATCAAAAG
AGCAGTTTTT TTAAGTACTT TTACAATACT AAATTTTTGT TACACATTAT TGTTATACTA ATAGAAAAAA AATAGTCAAA
GCTATACGAA CGAATAAAGT TGGTAGTGTA Atactcccta cctcagaata agtttatttt tgtctctccc atttatttta
aaataaattt atttttgaac actcattgca ctagagtttg tgaaagtaaa taatagatgc actggaatgt aggtaaaatg
aggaataatt gcattaagat ttgataaagt gagggtatgt ctttttgttt tatattggta catatgggat gagtgtaaaa
taaatttatt tttggaacag agAGAATATG TATTGAAACA CCGAGCAAGT ATTTTTCTTA TGATGGAAAG GACGCAAAAA
ATAACTAAAC AATAACAGTT CAGGGGGAGA GAGATAGAAT CAGAGAATTG CTGGAGTCGG CCCAAAACCA TCATTAACTG
GGCCCATTCG TCATATAGTT TGACTGAATG GTCTTATGCT GCGTCAGCCG TCAGCCGTCA GGACATTGGA ACTGGTCAAC
TGGATACTAC GATTACGAAG CCACTCTTGT TGTGTTGCTG ACCTGCTGTT GCATGCATGC ACGTAATATA ATTGATTACA
TTTGCATCTC TTAACTCATT CGTGAGAGCA GTGGCAGTGT GGCACTCTAC CATATTAACC GTACTGTTCT CTTTCTGCCG
CTGTTAATTT CAGGAGTCGG CAAGGACGGC CTGATCCGGC ACTTCTTCCA CCGCCCGTCG AAGGCGTACA CGACGGGGAC
GCGGAAGCGG CGGAAGGTGC ACACCGACGA GCAGGGCGGC GAGACGCGGT GGCACAAGAC CGGCAAGACG CGGCCGGTGT
TCACCGGCGG CAAGCTGAAG GGGTACAAGA AGATCCTGGT GCTCTACACC AACTACGGCA AGCAGCGCAA GCCGGAGAAG
ACCAACTGGG TGATGCACCA GTACCACCTG GGCTCCGACG AGGAGGAGAA GGACGGCGAG CTCGTCGTGT CCAAGGTGTT
CTACCAGACG CAGCCGAGGC AGTGCGGCGG CGGCTCGGCA GCGACGGCCA AGGACCTCTC CGTCGACCTC GTCGCCGGTA
ACAACATCAA GGCTAGCAAT GCTGCTGCTG AACACCACCA TAACGACGGC GTCGGCGGCG GCGGCCACGG TGGCAACAAC
AGCAGCATGC TGAAGGAAGC TGCAGGCATT GTAGATTTCT ACAACCCAGC GGCGGCGCTA ATCGGCTACA GCCAGGCGGC
TCCTAACAAC AGGGCGGCTG CTTCTGCTCA TTTGACGATG CCTAACTTTG AGGTGCACAC AGGAGGTGCA GGCTTTGGCC
CCTGATGGAT GGAAGAAAAC AAAGCAAATT AAACATATTT GACTGATGAT ATATATAGGT TAGATGGAGA GGGCAGGGCA
GGTATATGAT GGCAAATGTG CATCATGCAT GCTAGCATGG TGTAATTTGC ATCGAGTGAA AAAAAAGGAG TTTACTAAAC
CGTCTACGTA CGTATTACTG GACAATAAGG AGTGTGTCGA GTGAGTTGCT GCACAGATGT TGAAGCGTAG GGGGGTCGAT
ATTCTTACAG TGTTCATTAT TGTTACATGT GTACACATAT ATAACTTGAC ATTCTCAATT TTTTTGTTTA ATGATATATA
TATATATATA TATAT

Locus: Os01g0672100

Loading...

Locus: Os01g0672100

Loading...