Os01t0672400-01

Locus

Os01g0672400

Description

Drought induced 19 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDi19-3

Oryzabase Gene Name Synonym(s)

drought-induced 19-3

Transcript Evidence

AK061329 (DDBJ, Best hit)

Protein Evidence

Q5QMP3 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Drought induced 19/ RING finger protein 114 (IPR008598)

Full-length cDNA

006-303-A03 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0672400-01)

RiceXPro (AK061329)

Others

Oryzabase (18578)

KEGG (Os01t0672400-01)

Transcript

1374 bp

>Os01t0672400-01 Drought induced 19 family protein.
ACGGCGCGCACCATTTCTTCCCACCCGCTGCTGCTTCCTCGCCTTTCCGATAAGAAGCTT
CGCCGTCTCCTCCTCCTCTTTCCCTTCCTCCGCCGCTCCATCAAAAAATCTCCACAAGGC
TTAAGCAGAGGGAGGGTGAGGGATTAGAAACAAACAACCCTTCGGAGAAAATCACGAGAG
GCTTCCCGAGGGCAAAGTCTCCGATTCATTCAGGTCCGACTCGATCGGCGATCCGACGAA
GCTCGAGCAGGTGAGGGAGACGGACTCGGACTCGGAGCACGGAACCGGTATATTAGGGAG
GCTGAAGAGGGAGCTTGAGAGGGGGTCTAGCCTTAAGCTCGAACGCGGGGTGGTGGTTGT
ACCAGCAGCAGCAGGGAATCATGGACTCGGAGCACTGGATCTCGAGCCTCGCCGCCGCCA
AGCGGTTCTACGCGGCGCAGCTCGGTCACGTCGACGATATGGCGGGGATTGGAATGGAGG
AGGTGGAGATGGAGATGGAGGATGATGGCGAGGGCATGGAGCTGGAGCTGGAGATGCAGC
TGGAGGAGGCGACGTGGCCGGACGTGGCCTGCCCCTACTGCTACGAGGACCACGACATCG
CGTCCCTCTGCGCCCACCTCGAGGAGGACCACCCCTACGAGCCCCACACCTCGCCCTGTC
CCATCTGCTTCGAAAAGATTACAAGAGATATGTTAAATCATATCACCATGCAACATGGTT
ACTTGTTCAAGAGTGGTCGCAGGATGCGCAGATTCGATATTCCCGAGAGCCAGGCACTTT
CTTTACTGAGCCGAGATCTGCGGGATGCTCAGTTACAGGCACTTCTAGGAGGTGGTCATC
GTCAGCGAAGAAGCAACACTACTGCCACAAACATTTCTGCTGATCCTCTGCTTTCTTCGT
TTGGCCTGGGCTTCTCAACATTGGATTCAGAGGAACGATCAAAAGCACCAGTTCCTATTC
CTGATGATACATCAATTCATAAGGATACTCCTGCTCAGCCATGGGAATCAAGGATCGACT
CATCGCTCACGAGTGAGGAAAGGGAACAAAAGCGGAAACAAGCCACTGACAGAGCAACCT
TTGTGCAAGGCCTGGTGCTCTCCACTTTATTTGAAGACTGACTGTTCAAGTAGCCCTAGT
TTTTCTTGCTAGATGCATGTTTCCTCTCGCTGGTTCCCATAAAAGCGCAATGTTCCACCT
GATTTGGTGAATCTGATTTCGTCAACAGTGAGATGGATGTGCTTCTGGTGCCCCGTTGTT
CTTTCGCTTCAGTAAAGCGCGAAGTTGATTTGGGCATGATACACACCTTAATTTATGTCA
GCTGCCCTGTACCATTGCTTTTTATGAATTAACGGGTAGCCACACCTTGACTGT

CDS

741 bp

>Os01t0672400-01 Drought induced 19 family protein.
ATGGACTCGGAGCACTGGATCTCGAGCCTCGCCGCCGCCAAGCGGTTCTACGCGGCGCAG
CTCGGTCACGTCGACGATATGGCGGGGATTGGAATGGAGGAGGTGGAGATGGAGATGGAG
GATGATGGCGAGGGCATGGAGCTGGAGCTGGAGATGCAGCTGGAGGAGGCGACGTGGCCG
GACGTGGCCTGCCCCTACTGCTACGAGGACCACGACATCGCGTCCCTCTGCGCCCACCTC
GAGGAGGACCACCCCTACGAGCCCCACACCTCGCCCTGTCCCATCTGCTTCGAAAAGATT
ACAAGAGATATGTTAAATCATATCACCATGCAACATGGTTACTTGTTCAAGAGTGGTCGC
AGGATGCGCAGATTCGATATTCCCGAGAGCCAGGCACTTTCTTTACTGAGCCGAGATCTG
CGGGATGCTCAGTTACAGGCACTTCTAGGAGGTGGTCATCGTCAGCGAAGAAGCAACACT
ACTGCCACAAACATTTCTGCTGATCCTCTGCTTTCTTCGTTTGGCCTGGGCTTCTCAACA
TTGGATTCAGAGGAACGATCAAAAGCACCAGTTCCTATTCCTGATGATACATCAATTCAT
AAGGATACTCCTGCTCAGCCATGGGAATCAAGGATCGACTCATCGCTCACGAGTGAGGAA
AGGGAACAAAAGCGGAAACAAGCCACTGACAGAGCAACCTTTGTGCAAGGCCTGGTGCTC
TCCACTTTATTTGAAGACTGA

Protein

247 aa

>Os01t0672400-01 Drought induced 19 family protein.
MDSEHWISSLAAAKRFYAAQLGHVDDMAGIGMEEVEMEMEDDGEGMELELEMQLEEATWP
DVACPYCYEDHDIASLCAHLEEDHPYEPHTSPCPICFEKITRDMLNHITMQHGYLFKSGR
RMRRFDIPESQALSLLSRDLRDAQLQALLGGGHRQRRSNTTATNISADPLLSSFGLGFST
LDSEERSKAPVPIPDDTSIHKDTPAQPWESRIDSSLTSEEREQKRKQATDRATFVQGLVL
STLFED*

5'UTR

chr01:27601487..27601866 (+ strand) : 380 bp

CDS

chr01:27601867..27601942 (+ strand) : 76 bp

chr01:27602040..27602236 (+ strand) : 197 bp

chr01:27603384..27603461 (+ strand) : 78 bp

chr01:27603578..27603858 (+ strand) : 281 bp

chr01:27604437..27604545 (+ strand) : 109 bp

3'UTR

chr01:27604546..27604798 (+ strand) : 253 bp

FASTA

>Os01t0672400-01 class=Sequence position=chr01:27601487..27604798 (+ strand)
ACGGCGCGCA CCATTTCTTC CCACCCGCTG CTGCTTCCTC GCCTTTCCGA TAAGAAGCTT CGCCGTCTCC TCCTCCTCTT
TCCCTTCCTC CGCCGCTCCA TCAAAAAATC TCCACAAGGC TTAAGCAGAG GGAGGGTGAG GGATTAGAAA CAAACAACCC
TTCGGAGAAA ATCACGAGAG GCTTCCCGAG GGCAAAGTCT CCGATTCATT CAGGTCCGAC TCGATCGGCG ATCCGACGAA
GCTCGAGCAG GTGAGGGAGA CGGACTCGGA CTCGGAGCAC GGAACCGGTA TATTAGGGAG GCTGAAGAGG GAGCTTGAGA
GGGGGTCTAG CCTTAAGCTC GAACGCGGGG TGGTGGTTGT ACCAGCAGCA GCAGGGAATC ATGGACTCGG AGCACTGGAT
CTCGAGCCTC GCCGCCGCCA AGCGGTTCTA CGCGGCGCAG CTCGGTCACG TCGACGGTAT GCGGCCATCT CGACTTTTCC
CTCGAATCTT TGTTTGGCTT TCTGCTGTTG CTGTTGCTGA TTTGTGATTT GATTCGTTGG ATTGGGCGCG CAGATATGGC
GGGGATTGGA ATGGAGGAGG TGGAGATGGA GATGGAGGAT GATGGCGAGG GCATGGAGCT GGAGCTGGAG ATGCAGCTGG
AGGAGGCGAC GTGGCCGGAC GTGGCCTGCC CCTACTGCTA CGAGGACCAC GACATCGCGT CCCTCTGCGC CCACCTCGAG
GAGGACCACC CCTACGAGCC CCACACCTCG GTGAGCTCCT CGCCGCCATG CCCTGCGCCG CAGGGCTCCT TGCTCTGACG
CTCTGATGAC ATGACGCACA AAGTCTGGCA AAGCTGCTCC TTTTGTTCGA TTAGTAGGAA CGCTGTAGCT TTAGGGGTTG
ACTTGGCGAA TGAACTCAAT ATTTGGGCTA CTTGTGGAGT TGCGGTAGTA GCAAACTTGC GGGGTATCTT CTTGAAATAG
CCAAAATTCT TGAGATGATA GTATTATGCA AAGCTCCTCT AGCCTTGAGT TCTTGCCTCT CTATGGCTTG GCTTGCAATA
GTTTGTGAGC AAAGAGGTAG AATCTTTGGT ATCTGTATAG TATCAGTCAA CTACGGAGCA TAAGCTTATG GATTCAGAAC
TTGGCTGAAA ACACTAGCGA TTTGGACCGG GAAATTGTGA TTTTGTGATT CGTAGGTAGG GAAGTTGTGT TGTAGTTTTA
AGGGCAAGGA TAATTATATA TTTCTTATAA GAACTGTAGA TTATGCTTGA CTGAAGGTTT TAAATCAGTA GCCAGCATTG
TTCACTTCTG TAGTTGACTG CTCTAGCTTG TAGTTGTGTG TTCTATTTCA AGGCCTACTT CTGTAAACAA GGTAGCTAAT
TTCCTTTTTA TTTGATTGCC ACTATAGTAC TTATGTCACT GCGCCGACTG TGCACCCTAC TCTTGGTGGA CAGCTGCTCA
GTTGTCATAA ACTAAATGTT CATGAATACC ATGACTTAAA AACGTAATCC TCTGTTATTC ATCTAACTTC AGCAACAGGA
GTTGATTTTG CAATGGCACA AAATAACCTA GAAAAGTTAA TGATGGTAAT GTGATTTAGA TTTAAAAGAC TCGAACTGTT
GTGTGGGGTC CATTTTTAAG ATTTGGATTC ATTTTATTCT AGTGAAACAG AGGTGTTTGA GAATGCCATA TATATACTTT
TAATGTTATA ATCTCGTCTG AAGTTCGAGA TGTTAACTGC AGAAATCCTA GAATCTGAAA TAACCATTGT GCTTATTTGA
ATCTTTCGCT AAGTTTAGTA TCAAATAAGC ACATTGGGTT CAAAGTATAT TAAATCAGCA CCTTATGTTC ATATATTGTG
CATATAAAAT GTGCATTGTG TTCTTCTCCT GATTTATTTG CTTTGCTTTG CTTTCAGCCC TGTCCCATCT GCTTCGAAAA
GATTACAAGA GATATGTTAA ATCATATCAC CATGCAACAT GGTTACTTGT TCAAGGTTAA TCTCCTTCCA TACCTATTCT
GTTGCACAAG CATATGCTAA TTCTTTGATA AATTTTCTTA ATTATTTAGG AATGTTCTGA TTCCTTTTTC AAAATTATTT
GTGATGTACA GAGTGGTCGC AGGATGCGCA GATTCGATAT TCCCGAGAGC CAGGCACTTT CTTTACTGAG CCGAGATCTG
CGGGATGCTC AGTTACAGGC ACTTCTAGGA GGTGGTCATC GTCAGCGAAG AAGCAACACT ACTGCCACAA ACATTTCTGC
TGATCCTCTG CTTTCTTCGT TTGGCCTGGG CTTCTCAACA TTGGATTCAG AGGAACGATC AAAAGCACCA GTTCCTATTC
CTGATGATAC ATCAATTCAT AAGGATACTC CTGCTCAGCC ATGGGAATCA AGGTATATAT ATTTACACTG CTCAGCCGAA
TCACATTAGT GGCCTGATAT TCTTCCACCT AAAACCCCAC TACTAACAGC ATTACTTCAA GAATCATCCT AGTTTGTCTG
GAAAGCATAG CAAACACTAT TGAGTATTAG CCAATTAGTT CCCATGTCCT GCCATGCTCT ATGATTTATT TTTCAGCTAG
CACTTTCACA AACTGTTCAC AGTTACCTTC TTGTCTGAGA CAGGTACTGT CAATTTTGTT ACATATGTCA GAAAGACTAT
CAACCACCAG TTAAACAGTT GTGTCCTTGT GATTTTTTAG ACTGTTCACT AGCTGTACGC TTTTACATTT GATGAAAACA
GTCCATATTA TGTCAATGAA TTGTTAAGTA GCTCTAAGAT TGACCATATT CACAACTATA AAGGTCTACA TAATACTTGC
CGTTTCCCCT AGCATTCAGA TGGTCAGACC AATTAGGTAA AGTAGAGCAT TCAGGTCTAT ATATGTGCTC AGTTAGTATG
TTTCAAACCA GCAGCTTATA AACTCCTTAA GAGATATGCA AATATGAAAT ATTTATTTTT TCCATGGCAG GATCGACTCA
TCGCTCACGA GTGAGGAAAG GGAACAAAAG CGGAAACAAG CCACTGACAG AGCAACCTTT GTGCAAGGCC TGGTGCTCTC
CACTTTATTT GAAGACTGAC TGTTCAAGTA GCCCTAGTTT TTCTTGCTAG ATGCATGTTT CCTCTCGCTG GTTCCCATAA
AAGCGCAATG TTCCACCTGA TTTGGTGAAT CTGATTTCGT CAACAGTGAG ATGGATGTGC TTCTGGTGCC CCGTTGTTCT
TTCGCTTCAG TAAAGCGCGA AGTTGATTTG GGCATGATAC ACACCTTAAT TTATGTCAGC TGCCCTGTAC CATTGCTTTT
TATGAATTAA CGGGTAGCCA CACCTTGACT GT

Locus: Os01g0672400

Loading...

Locus: Os01g0672400

Loading...