Os01t0672400-02

Locus

Os01g0672400

Description

Similar to Protein DEHYDRATION-INDUCED 19 homolog 3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDi19-3

Oryzabase Gene Name Synonym(s)

drought-induced 19-3

Transcript Evidence

AK064817 (DDBJ, Best hit)

Protein Evidence

Q5QMP3 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Drought induced 19/ RING finger protein 114 (IPR008598)

Full-length cDNA

J013000E14 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0672400-02)

RiceXPro (AK064817)

Others

Oryzabase (18578)

KEGG (Os01t0672400-02)

Transcript

2618 bp

>Os01t0672400-02 Similar to Protein DEHYDRATION-INDUCED 19 homolog 3.
TCCCACCCGCTGCTGCTTCCTCGCCTTTCCGATAAGAAGCTTCGCCGTCTCCTCCTCCTC
TTTCCCTTCCTCCGCCGCTCCATCAAAAAATCTCCACAAGGCTTAAGCAGAGGGAGGGTG
AGGGATTAGAAACAAACAACCCTTCGGAGAAAATCACGAGAGGCTTCCCGAGGGCAAAGT
CTCCGATTCATTCAGGTCCGACTCGATCGGCGATCCGACGAAGCTCGAGCAGGTGAGGGA
GACGGACTCGGACTCGGAGCACGGAACCGGTATATTAGGGAGGCTGAAGAGGGAGCTTGA
GAGGGGGTCTAGCCTTAAGCTCGAACGCGGGGTGGTGGTTGTACCAGCAGCAGCAGGGAA
TCATGGACTCGGAGCACTGGATCTCGAGCCTCGCCGCCGCCAAGCGGTTCTACGCGGCGC
AGCTCGGTCACGTCGACGATATGGCGGGGATTGGAATGGAGGAGGTGGAGATGGAGATGG
AGGATGATGGCGAGGGCATGGAGCTGGAGCTGGAGATGCAGCTGGAGGAGGCGACGTGGC
CGGACGTGGCCTGCCCCTACTGCTACGAGGACCACGACATCGCGTCCCTCTGCGCCCACC
TCGAGGAGGACCACCCCTACGAGCCCCACACCTCGGTGAGCTCCTCGCCGCCATGCCCTG
CGCCGCAGGGCTCCTTGCTCTGACGCTCTGATGACATGACGCACAAAGTCTGGCAAAGCT
GCTCCTTTTGTTCGATTAGTAGGAACGCTGTAGCTTTAGGGGTTGACTTGGCGAATGAAC
TCAATATTTGGGCTACTTGTGGAGTTGCGGTAGTAGCAAACTTGCGGGGTATCTTCTTGA
AATAGCCAAAATTCTTGAGATGATAGTATTATGCAAAGCTCCTCTAGCCTTGAGTTCTTG
CCTCTCTATGGCTTGGCTTGCAATAGTTTGTGAGCAAAGAGGTAGAATCTTTGGTATCTG
TATAGTATCAGTCAACTACGGAGCATAAGCTTATGGATTCAGAACTTGGCTGAAAACACT
AGCGATTTGGACCGGGAAATTGTGATTTTGTGATTCGTAGGTAGGGAAGTTGTGTTGTAG
TTTTAAGGGCAAGGATAATTATATATTTCTTATAAGAACTGTAGATTATGCTTGACTGAA
GGTTTTAAATCAGTAGCCAGCATTGTTCACTTCTGTAGTTGACTGCTCTAGCTTGTAGTT
GTGTGTTCTATTTCAAGGCCTACTTCTGTAAACAAGGTAGCTAATTTCCTTTTTATTTGA
TTGCCACTATAGTACTTATGTCACTGCGCCGACTGTGCACCCTACTCTTGGTGGACAGCT
GCTCAGTTGTCATAAACTAAATGTTCATGAATACCATGACTTAAAAACGTAATCCTCTGT
TATTCATCTAACTTCAGCAACAGGAGTTGATTTTGCAATGGCACAAAATAACCTAGAAAA
GTTAATGATGGTAATGTGATTTAGATTTAAAAGACTCGAACTGTTGTGTGGGGTCCATTT
TTAAGATTTGGATTCATTTTATTCTAGTGAAACAGAGGTGTTTGAGAATGCCATATATAT
ACTTTTAATGTTATAATCTCGTCTGAAGTTCGAGATGTTAACTGCAGAAATCCTAGAATC
TGAAATAACCATTGTGCTTATTTGAATCTTTCGCTAAGTTTAGTATCAAATAAGCACATT
GGGTTCAAAGTATATTAAATCAGCACCTTATGTTCATATATTGTGCATATAAAATGTGCA
TTGTGTTCTTCTCCTGATTTATTTGCTTTGCTTTGCTTTCAGCCCTGTCCCATCTGCTTC
GAAAAGATTACAAGAGATATGTTAAATCATATCACCATGCAACATGGTTACTTGTTCAAG
AGTGGTCGCAGGATGCGCAGATTCGATATTCCCGAGAGCCAGGCACTTTCTTTACTGAGC
CGAGATCTGCGGGATGCTCAGTTACAGGCACTTCTAGGAGGTGGTCATCGTCAGCGAAGA
AGCAACACTACTGCCACAAACATTTCTGCTGATCCTCTGCTTTCTTCGTTTGGCCTGGGC
TTCTCAACATTGGATTCAGAGGAACGATCAAAAGCACCAGTTCCTATTCCTGATGATACA
TCAATTCATAAGGATACTCCTGCTCAGCCATGGGAATCAAGGATCGACTCATCGCTCACG
AGTGAGGAAAGGGAACAAAAGCGGAAACAAGCCACTGACAGAGCAACCTTTGTGCAAGGC
CTGGTGCTCTCCACTTTATTTGAAGACTGACTGTTCAAGTAGCCCTAGTTTTTCTTGCTA
GATGCATGTTTCCTCTCGCTGGTTCCCATAAAAGCGCAATGTTCCACCTGATTTGGTGAA
TCTGATTTCGTCAACAGTGAGATGGATGTGCTTCTGGTGCCCCGTTGTTCTTTCGCTTCA
GTAAAGCGCGAAGTTGATTTGGGCATGATACACACCTTAATTTATGTCAGCTGCCCTGTA
CCATTGCTTTTTATGAATTAACGGGTAGCCACACCTTGACTGTAACTCGTTGTTGTACCT
CTCCATACTGTCTAGGAACATTGGTTTGTACAAACATAAAAGCTGTTACATGTTGTACAA
TGCAAAGGCAAATGCAGAAGCACCGTTTATATCGAATC

CDS

321 bp

>Os01t0672400-02 Similar to Protein DEHYDRATION-INDUCED 19 homolog 3.
ATGGACTCGGAGCACTGGATCTCGAGCCTCGCCGCCGCCAAGCGGTTCTACGCGGCGCAG
CTCGGTCACGTCGACGATATGGCGGGGATTGGAATGGAGGAGGTGGAGATGGAGATGGAG
GATGATGGCGAGGGCATGGAGCTGGAGCTGGAGATGCAGCTGGAGGAGGCGACGTGGCCG
GACGTGGCCTGCCCCTACTGCTACGAGGACCACGACATCGCGTCCCTCTGCGCCCACCTC
GAGGAGGACCACCCCTACGAGCCCCACACCTCGGTGAGCTCCTCGCCGCCATGCCCTGCG
CCGCAGGGCTCCTTGCTCTGA

Protein

107 aa

>Os01t0672400-02 Similar to Protein DEHYDRATION-INDUCED 19 homolog 3.
MDSEHWISSLAAAKRFYAAQLGHVDDMAGIGMEEVEMEMEDDGEGMELELEMQLEEATWP
DVACPYCYEDHDIASLCAHLEEDHPYEPHTSVSSSPPCPAPQGSLL*

5'UTR

chr01:27601505..27601866 (+ strand) : 362 bp

CDS

chr01:27601867..27601942 (+ strand) : 76 bp

chr01:27602040..27602284 (+ strand) : 245 bp

3'UTR

chr01:27602285..27603461 (+ strand) : 1177 bp

chr01:27603578..27603858 (+ strand) : 281 bp

chr01:27604437..27604913 (+ strand) : 477 bp

FASTA

>Os01t0672400-02 class=Sequence position=chr01:27601505..27604913 (+ strand)
TCCCACCCGC TGCTGCTTCC TCGCCTTTCC GATAAGAAGC TTCGCCGTCT CCTCCTCCTC TTTCCCTTCC TCCGCCGCTC
CATCAAAAAA TCTCCACAAG GCTTAAGCAG AGGGAGGGTG AGGGATTAGA AACAAACAAC CCTTCGGAGA AAATCACGAG
AGGCTTCCCG AGGGCAAAGT CTCCGATTCA TTCAGGTCCG ACTCGATCGG CGATCCGACG AAGCTCGAGC AGGTGAGGGA
GACGGACTCG GACTCGGAGC ACGGAACCGG TATATTAGGG AGGCTGAAGA GGGAGCTTGA GAGGGGGTCT AGCCTTAAGC
TCGAACGCGG GGTGGTGGTT GTACCAGCAG CAGCAGGGAA TCATGGACTC GGAGCACTGG ATCTCGAGCC TCGCCGCCGC
CAAGCGGTTC TACGCGGCGC AGCTCGGTCA CGTCGACGGT ATGCGGCCAT CTCGACTTTT CCCTCGAATC TTTGTTTGGC
TTTCTGCTGT TGCTGTTGCT GATTTGTGAT TTGATTCGTT GGATTGGGCG CGCAGATATG GCGGGGATTG GAATGGAGGA
GGTGGAGATG GAGATGGAGG ATGATGGCGA GGGCATGGAG CTGGAGCTGG AGATGCAGCT GGAGGAGGCG ACGTGGCCGG
ACGTGGCCTG CCCCTACTGC TACGAGGACC ACGACATCGC GTCCCTCTGC GCCCACCTCG AGGAGGACCA CCCCTACGAG
CCCCACACCT CGGTGAGCTC CTCGCCGCCA TGCCCTGCGC CGCAGGGCTC CTTGCTCTGA CGCTCTGATG ACATGACGCA
CAAAGTCTGG CAAAGCTGCT CCTTTTGTTC GATTAGTAGG AACGCTGTAG CTTTAGGGGT TGACTTGGCG AATGAACTCA
ATATTTGGGC TACTTGTGGA GTTGCGGTAG TAGCAAACTT GCGGGGTATC TTCTTGAAAT AGCCAAAATT CTTGAGATGA
TAGTATTATG CAAAGCTCCT CTAGCCTTGA GTTCTTGCCT CTCTATGGCT TGGCTTGCAA TAGTTTGTGA GCAAAGAGGT
AGAATCTTTG GTATCTGTAT AGTATCAGTC AACTACGGAG CATAAGCTTA TGGATTCAGA ACTTGGCTGA AAACACTAGC
GATTTGGACC GGGAAATTGT GATTTTGTGA TTCGTAGGTA GGGAAGTTGT GTTGTAGTTT TAAGGGCAAG GATAATTATA
TATTTCTTAT AAGAACTGTA GATTATGCTT GACTGAAGGT TTTAAATCAG TAGCCAGCAT TGTTCACTTC TGTAGTTGAC
TGCTCTAGCT TGTAGTTGTG TGTTCTATTT CAAGGCCTAC TTCTGTAAAC AAGGTAGCTA ATTTCCTTTT TATTTGATTG
CCACTATAGT ACTTATGTCA CTGCGCCGAC TGTGCACCCT ACTCTTGGTG GACAGCTGCT CAGTTGTCAT AAACTAAATG
TTCATGAATA CCATGACTTA AAAACGTAAT CCTCTGTTAT TCATCTAACT TCAGCAACAG GAGTTGATTT TGCAATGGCA
CAAAATAACC TAGAAAAGTT AATGATGGTA ATGTGATTTA GATTTAAAAG ACTCGAACTG TTGTGTGGGG TCCATTTTTA
AGATTTGGAT TCATTTTATT CTAGTGAAAC AGAGGTGTTT GAGAATGCCA TATATATACT TTTAATGTTA TAATCTCGTC
TGAAGTTCGA GATGTTAACT GCAGAAATCC TAGAATCTGA AATAACCATT GTGCTTATTT GAATCTTTCG CTAAGTTTAG
TATCAAATAA GCACATTGGG TTCAAAGTAT ATTAAATCAG CACCTTATGT TCATATATTG TGCATATAAA ATGTGCATTG
TGTTCTTCTC CTGATTTATT TGCTTTGCTT TGCTTTCAGC CCTGTCCCAT CTGCTTCGAA AAGATTACAA GAGATATGTT
AAATCATATC ACCATGCAAC ATGGTTACTT GTTCAAGGTT AATCTCCTTC CATACCTATT CTGTTGCACA AGCATATGCT
AATTCTTTGA TAAATTTTCT TAATTATTTA GGAATGTTCT GATTCCTTTT TCAAAATTAT TTGTGATGTA CAGAGTGGTC
GCAGGATGCG CAGATTCGAT ATTCCCGAGA GCCAGGCACT TTCTTTACTG AGCCGAGATC TGCGGGATGC TCAGTTACAG
GCACTTCTAG GAGGTGGTCA TCGTCAGCGA AGAAGCAACA CTACTGCCAC AAACATTTCT GCTGATCCTC TGCTTTCTTC
GTTTGGCCTG GGCTTCTCAA CATTGGATTC AGAGGAACGA TCAAAAGCAC CAGTTCCTAT TCCTGATGAT ACATCAATTC
ATAAGGATAC TCCTGCTCAG CCATGGGAAT CAAGGTATAT ATATTTACAC TGCTCAGCCG AATCACATTA GTGGCCTGAT
ATTCTTCCAC CTAAAACCCC ACTACTAACA GCATTACTTC AAGAATCATC CTAGTTTGTC TGGAAAGCAT AGCAAACACT
ATTGAGTATT AGCCAATTAG TTCCCATGTC CTGCCATGCT CTATGATTTA TTTTTCAGCT AGCACTTTCA CAAACTGTTC
ACAGTTACCT TCTTGTCTGA GACAGGTACT GTCAATTTTG TTACATATGT CAGAAAGACT ATCAACCACC AGTTAAACAG
TTGTGTCCTT GTGATTTTTT AGACTGTTCA CTAGCTGTAC GCTTTTACAT TTGATGAAAA CAGTCCATAT TATGTCAATG
AATTGTTAAG TAGCTCTAAG ATTGACCATA TTCACAACTA TAAAGGTCTA CATAATACTT GCCGTTTCCC CTAGCATTCA
GATGGTCAGA CCAATTAGGT AAAGTAGAGC ATTCAGGTCT ATATATGTGC TCAGTTAGTA TGTTTCAAAC CAGCAGCTTA
TAAACTCCTT AAGAGATATG CAAATATGAA ATATTTATTT TTTCCATGGC AGGATCGACT CATCGCTCAC GAGTGAGGAA
AGGGAACAAA AGCGGAAACA AGCCACTGAC AGAGCAACCT TTGTGCAAGG CCTGGTGCTC TCCACTTTAT TTGAAGACTG
ACTGTTCAAG TAGCCCTAGT TTTTCTTGCT AGATGCATGT TTCCTCTCGC TGGTTCCCAT AAAAGCGCAA TGTTCCACCT
GATTTGGTGA ATCTGATTTC GTCAACAGTG AGATGGATGT GCTTCTGGTG CCCCGTTGTT CTTTCGCTTC AGTAAAGCGC
GAAGTTGATT TGGGCATGAT ACACACCTTA ATTTATGTCA GCTGCCCTGT ACCATTGCTT TTTATGAATT AACGGGTAGC
CACACCTTGA CTGTAACTCG TTGTTGTACC TCTCCATACT GTCTAGGAAC ATTGGTTTGT ACAAACATAA AAGCTGTTAC
ATGTTGTACA ATGCAAAGGC AAATGCAGAA GCACCGTTTA TATCGAATC

Locus: Os01g0672400

Loading...

Locus: Os01g0672400

Loading...