Os01t0672400-03

Locus

Os01g0672400

Description

Drought induced 19 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDi19-3

Oryzabase Gene Name Synonym(s)

drought-induced 19-3

Transcript Evidence

AK060901 (DDBJ, Best hit)

Protein Evidence

Q5QMP3 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Drought induced 19/ RING finger protein 114 (IPR008598)

Full-length cDNA

001-035-D08 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0672400-03)

RiceXPro (AK060901)

Others

Oryzabase (18578)

KEGG (Os01t0672400-03)

Transcript

1364 bp

>Os01t0672400-03 Drought induced 19 family protein.
TTCGCCGTCTCCTCCTCCTCTTTCCCTTCCTCCGCCGCTCCATCAAAAAATCTCCACAAG
GCTTAAGCAGAGGGAGGGTGAGGGATTAGAAACAAACAACCCTTCGGAGAAAATCACGAG
AGGCTTCCCGAGGGCAAAGTCTCCGATTCATTCAGGTCCGACTCGATCGGCGATCCGACG
AAGCTCGAGCAGGTGAGGGAGACGGACTCGGACTCGGAGCACGGAACCGGTATATTAGGG
AGGCTGAAGAGGGAGCTTGAGAGGGGGTCTAGCCTTAAGCTCGAACGCGGGGTGGTGGTT
GTACCAGCAGCAGCAGGGAATCATGGACTCGGAGCACTGGATCTCGAGCCTCGCCGCCGC
CAAGCGGTTCTACGCGGCGCAGCTCGGTCACGTCGACGATATGGCGGGGATTGGAATGGA
GGAGGTGGAGATGGAGATGGAGGATGATGGCGAGGGCATGGAGCTGGAGCTGGAGATGCA
GCTGGAGGAGGCGACGTGGCCGGACGTGGCCTGCCCCTACTGCTACGAGGACCACGACAT
CGCGTCCCTCTGCGCCCACCTCGAGGAGGACCACCCCTACGAGCCCCACACCTCGCCCTG
TCCCATCTGCTTCGAAAAGATTACAAGAGATATGTTAAATCATATCACCATGCAACATGG
TTACTTGTTCAAGAGTGGTCGCAGGATGCGCAGATTCGATATTCCCGAGAGCCAGGCACT
TTCTTTACTGAGCCGAGATCTGCGGGATGCTCAGTTACAGGCACTTCTAGGAGGTGGTCA
TCGTCAGCGAAGAAGCAACACTACTGCCACAAACATTTCTGCTGATCCTCTGCTTTCTTC
GTTTGGCCTGGGCTTCTCAACATTGGATTCAGAGGAACGATCAAAAGCACCAGTTCCTAT
TCCTGATGATACATCAATTCATAAGGATACTCCTGCTCAGCCATGGGAATCAAGGATCGA
CTCATCGCTCACGAGTGAGGAAAGGGAACAAAAGCGGAAACAAGCCACTGACAGAGCAAC
CTTTGTGCAAGGCCTGGTGCTCTCCACTTTATTTGAAGACTGACTGTTCAAGTAGCCCTA
GTTTTTCTTGCTAGATGCATGTTTCCTCTCGCTGGTTCCCATAAAAGCGCAATGTTCCAC
CTGATTTGGTGAATCTGATTTCGTCAACAGTGAGATGGATGTGCTTCTGGTGCCCCGTTG
TTCTTTCGCTTCAGTAAAGCGCGAAGTTGATTTGGGCATGATACACACCTTAATTTATGT
CAGCTGCCCTGTACCATTGCTTTTTATGAATTAACGGGTAGCCACACCTTGACTGTAACT
CGTTGTTGTACCTCTCCATACTGTCTAGGAACATTGGTTTGTAC

CDS

741 bp

>Os01t0672400-03 Drought induced 19 family protein.
ATGGACTCGGAGCACTGGATCTCGAGCCTCGCCGCCGCCAAGCGGTTCTACGCGGCGCAG
CTCGGTCACGTCGACGATATGGCGGGGATTGGAATGGAGGAGGTGGAGATGGAGATGGAG
GATGATGGCGAGGGCATGGAGCTGGAGCTGGAGATGCAGCTGGAGGAGGCGACGTGGCCG
GACGTGGCCTGCCCCTACTGCTACGAGGACCACGACATCGCGTCCCTCTGCGCCCACCTC
GAGGAGGACCACCCCTACGAGCCCCACACCTCGCCCTGTCCCATCTGCTTCGAAAAGATT
ACAAGAGATATGTTAAATCATATCACCATGCAACATGGTTACTTGTTCAAGAGTGGTCGC
AGGATGCGCAGATTCGATATTCCCGAGAGCCAGGCACTTTCTTTACTGAGCCGAGATCTG
CGGGATGCTCAGTTACAGGCACTTCTAGGAGGTGGTCATCGTCAGCGAAGAAGCAACACT
ACTGCCACAAACATTTCTGCTGATCCTCTGCTTTCTTCGTTTGGCCTGGGCTTCTCAACA
TTGGATTCAGAGGAACGATCAAAAGCACCAGTTCCTATTCCTGATGATACATCAATTCAT
AAGGATACTCCTGCTCAGCCATGGGAATCAAGGATCGACTCATCGCTCACGAGTGAGGAA
AGGGAACAAAAGCGGAAACAAGCCACTGACAGAGCAACCTTTGTGCAAGGCCTGGTGCTC
TCCACTTTATTTGAAGACTGA

Protein

247 aa

>Os01t0672400-03 Drought induced 19 family protein.
MDSEHWISSLAAAKRFYAAQLGHVDDMAGIGMEEVEMEMEDDGEGMELELEMQLEEATWP
DVACPYCYEDHDIASLCAHLEEDHPYEPHTSPCPICFEKITRDMLNHITMQHGYLFKSGR
RMRRFDIPESQALSLLSRDLRDAQLQALLGGGHRQRRSNTTATNISADPLLSSFGLGFST
LDSEERSKAPVPIPDDTSIHKDTPAQPWESRIDSSLTSEEREQKRKQATDRATFVQGLVL
STLFED*

5'UTR

chr01:27601545..27601866 (+ strand) : 322 bp

CDS

chr01:27601867..27601942 (+ strand) : 76 bp

chr01:27602040..27602236 (+ strand) : 197 bp

chr01:27603384..27603461 (+ strand) : 78 bp

chr01:27603578..27603858 (+ strand) : 281 bp

chr01:27604437..27604545 (+ strand) : 109 bp

3'UTR

chr01:27604546..27604846 (+ strand) : 301 bp

FASTA

>Os01t0672400-03 class=Sequence position=chr01:27601545..27604846 (+ strand)
TTCGCCGTCT CCTCCTCCTC TTTCCCTTCC TCCGCCGCTC CATCAAAAAA TCTCCACAAG GCTTAAGCAG AGGGAGGGTG
AGGGATTAGA AACAAACAAC CCTTCGGAGA AAATCACGAG AGGCTTCCCG AGGGCAAAGT CTCCGATTCA TTCAGGTCCG
ACTCGATCGG CGATCCGACG AAGCTCGAGC AGGTGAGGGA GACGGACTCG GACTCGGAGC ACGGAACCGG TATATTAGGG
AGGCTGAAGA GGGAGCTTGA GAGGGGGTCT AGCCTTAAGC TCGAACGCGG GGTGGTGGTT GTACCAGCAG CAGCAGGGAA
TCATGGACTC GGAGCACTGG ATCTCGAGCC TCGCCGCCGC CAAGCGGTTC TACGCGGCGC AGCTCGGTCA CGTCGACGGT
ATGCGGCCAT CTCGACTTTT CCCTCGAATC TTTGTTTGGC TTTCTGCTGT TGCTGTTGCT GATTTGTGAT TTGATTCGTT
GGATTGGGCG CGCAGATATG GCGGGGATTG GAATGGAGGA GGTGGAGATG GAGATGGAGG ATGATGGCGA GGGCATGGAG
CTGGAGCTGG AGATGCAGCT GGAGGAGGCG ACGTGGCCGG ACGTGGCCTG CCCCTACTGC TACGAGGACC ACGACATCGC
GTCCCTCTGC GCCCACCTCG AGGAGGACCA CCCCTACGAG CCCCACACCT CGGTGAGCTC CTCGCCGCCA TGCCCTGCGC
CGCAGGGCTC CTTGCTCTGA CGCTCTGATG ACATGACGCA CAAAGTCTGG CAAAGCTGCT CCTTTTGTTC GATTAGTAGG
AACGCTGTAG CTTTAGGGGT TGACTTGGCG AATGAACTCA ATATTTGGGC TACTTGTGGA GTTGCGGTAG TAGCAAACTT
GCGGGGTATC TTCTTGAAAT AGCCAAAATT CTTGAGATGA TAGTATTATG CAAAGCTCCT CTAGCCTTGA GTTCTTGCCT
CTCTATGGCT TGGCTTGCAA TAGTTTGTGA GCAAAGAGGT AGAATCTTTG GTATCTGTAT AGTATCAGTC AACTACGGAG
CATAAGCTTA TGGATTCAGA ACTTGGCTGA AAACACTAGC GATTTGGACC GGGAAATTGT GATTTTGTGA TTCGTAGGTA
GGGAAGTTGT GTTGTAGTTT TAAGGGCAAG GATAATTATA TATTTCTTAT AAGAACTGTA GATTATGCTT GACTGAAGGT
TTTAAATCAG TAGCCAGCAT TGTTCACTTC TGTAGTTGAC TGCTCTAGCT TGTAGTTGTG TGTTCTATTT CAAGGCCTAC
TTCTGTAAAC AAGGTAGCTA ATTTCCTTTT TATTTGATTG CCACTATAGT ACTTATGTCA CTGCGCCGAC TGTGCACCCT
ACTCTTGGTG GACAGCTGCT CAGTTGTCAT AAACTAAATG TTCATGAATA CCATGACTTA AAAACGTAAT CCTCTGTTAT
TCATCTAACT TCAGCAACAG GAGTTGATTT TGCAATGGCA CAAAATAACC TAGAAAAGTT AATGATGGTA ATGTGATTTA
GATTTAAAAG ACTCGAACTG TTGTGTGGGG TCCATTTTTA AGATTTGGAT TCATTTTATT CTAGTGAAAC AGAGGTGTTT
GAGAATGCCA TATATATACT TTTAATGTTA TAATCTCGTC TGAAGTTCGA GATGTTAACT GCAGAAATCC TAGAATCTGA
AATAACCATT GTGCTTATTT GAATCTTTCG CTAAGTTTAG TATCAAATAA GCACATTGGG TTCAAAGTAT ATTAAATCAG
CACCTTATGT TCATATATTG TGCATATAAA ATGTGCATTG TGTTCTTCTC CTGATTTATT TGCTTTGCTT TGCTTTCAGC
CCTGTCCCAT CTGCTTCGAA AAGATTACAA GAGATATGTT AAATCATATC ACCATGCAAC ATGGTTACTT GTTCAAGGTT
AATCTCCTTC CATACCTATT CTGTTGCACA AGCATATGCT AATTCTTTGA TAAATTTTCT TAATTATTTA GGAATGTTCT
GATTCCTTTT TCAAAATTAT TTGTGATGTA CAGAGTGGTC GCAGGATGCG CAGATTCGAT ATTCCCGAGA GCCAGGCACT
TTCTTTACTG AGCCGAGATC TGCGGGATGC TCAGTTACAG GCACTTCTAG GAGGTGGTCA TCGTCAGCGA AGAAGCAACA
CTACTGCCAC AAACATTTCT GCTGATCCTC TGCTTTCTTC GTTTGGCCTG GGCTTCTCAA CATTGGATTC AGAGGAACGA
TCAAAAGCAC CAGTTCCTAT TCCTGATGAT ACATCAATTC ATAAGGATAC TCCTGCTCAG CCATGGGAAT CAAGGTATAT
ATATTTACAC TGCTCAGCCG AATCACATTA GTGGCCTGAT ATTCTTCCAC CTAAAACCCC ACTACTAACA GCATTACTTC
AAGAATCATC CTAGTTTGTC TGGAAAGCAT AGCAAACACT ATTGAGTATT AGCCAATTAG TTCCCATGTC CTGCCATGCT
CTATGATTTA TTTTTCAGCT AGCACTTTCA CAAACTGTTC ACAGTTACCT TCTTGTCTGA GACAGGTACT GTCAATTTTG
TTACATATGT CAGAAAGACT ATCAACCACC AGTTAAACAG TTGTGTCCTT GTGATTTTTT AGACTGTTCA CTAGCTGTAC
GCTTTTACAT TTGATGAAAA CAGTCCATAT TATGTCAATG AATTGTTAAG TAGCTCTAAG ATTGACCATA TTCACAACTA
TAAAGGTCTA CATAATACTT GCCGTTTCCC CTAGCATTCA GATGGTCAGA CCAATTAGGT AAAGTAGAGC ATTCAGGTCT
ATATATGTGC TCAGTTAGTA TGTTTCAAAC CAGCAGCTTA TAAACTCCTT AAGAGATATG CAAATATGAA ATATTTATTT
TTTCCATGGC AGGATCGACT CATCGCTCAC GAGTGAGGAA AGGGAACAAA AGCGGAAACA AGCCACTGAC AGAGCAACCT
TTGTGCAAGG CCTGGTGCTC TCCACTTTAT TTGAAGACTG ACTGTTCAAG TAGCCCTAGT TTTTCTTGCT AGATGCATGT
TTCCTCTCGC TGGTTCCCAT AAAAGCGCAA TGTTCCACCT GATTTGGTGA ATCTGATTTC GTCAACAGTG AGATGGATGT
GCTTCTGGTG CCCCGTTGTT CTTTCGCTTC AGTAAAGCGC GAAGTTGATT TGGGCATGAT ACACACCTTA ATTTATGTCA
GCTGCCCTGT ACCATTGCTT TTTATGAATT AACGGGTAGC CACACCTTGA CTGTAACTCG TTGTTGTACC TCTCCATACT
GTCTAGGAAC ATTGGTTTGT AC

Locus: Os01g0672400

Loading...

Locus: Os01g0672400

Loading...