Os01t0672400-04

Locus

Os01g0672400

Description

Drought induced 19 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDi19-3

Oryzabase Gene Name Synonym(s)

drought-induced 19-3

Transcript Evidence

AK101922 (DDBJ, Best hit)

Protein Evidence

Q5QMP3 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Drought induced 19/ RING finger protein 114 (IPR008598)

Full-length cDNA

J033071L05 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0672400-04)

RiceXPro (AK101922)

Others

Oryzabase (18578)

KEGG (Os01t0672400-04)

Transcript

1157 bp

>Os01t0672400-04 Drought induced 19 family protein.
AGCCTTAAGCTCGAACGCGGGGTGGTGGTTGTACCAGCAGCAGCAGGGAATCATGGACTC
GGAGCACTGGATCTCGAGCCTCGCCGCCGCCAAGCGGTTCTACGCGGCGCAGCTCGGTCA
CGTCGACGATATGGCGGGGATTGGAATGGAGGAGGTGGAGATGGAGATGGAGGATGATGG
CGAGGGCATGGAGCTGGAGCTGGAGATGCAGCTGGAGGAGGCGACGTGGCCGGACGTGGC
CTGCCCCTACTGCTACGAGGACCACGACATCGCGTCCCTCTGCGCCCACCTCGAGGAGGA
CCACCCCTACGAGCCCCACACCTCGCCCTGTCCCATCTGCTTCGAAAAGATTACAAGAGA
TATGTTAAATCATATCACCATGCAACATGGTTACTTGTTCAAGAGTGGTCGCAGGATGCG
CAGATTCGATATTCCCGAGAGCCAGGCACTTTCTTTACTGAGCCGAGATCTGCGGGATGC
TCAGTTACAGGCACTTCTAGGAGGTGGTCATCGTCAGCGAAGAAGCAACACTACTGCCAC
AAACATTTCTGCTGATCCTCTGCTTTCTTCGTTTGGCCTGGGCTTCTCAACATTGGATTC
AGAGGAACGATCAAAAGCACCAGTTCCTATTCCTGATGATACATCAATTCATAAGGATAC
TCCTGCTCAGCCATGGGAATCAAGGATCGACTCATCGCTCACGAGTGAGGAAAGGGAACA
AAAGCGGAAACAAGCCACTGACAGAGCAACCTTTGTGCAAGGCCTGGTGCTCTCCACTTT
ATTTGAAGACTGACTGTTCAAGTAGCCCTAGTTTTTCTTGCTAGATGCATGTTTCCTCTC
GCTGGTTCCCATAAAAGCGCAATGTTCCACCTGATTTGGTGAATCTGATTTCGTCAACAG
TGAGATGGATGTGCTTCTGGTGCCCCGTTGTTCTTTCGCTTCAGTAAAGCGCGAAGTTGA
TTTGGGCATGATACACACCTTAATTTATGTCAGCTGCCCTGTACCATTGCTTTTTATGAA
TTAACGGGTAGCCACACCTTGACTGTAACTCGTTGTTGTACCTCTCCATACTGTCTAGGA
ACATTGGTTTGTACAAACATAAAAGCTGTTACATGTTGTACAATGCAAAGGCAAATGCAG
AAGCACCGTTTATATCG

CDS

741 bp

>Os01t0672400-04 Drought induced 19 family protein.
ATGGACTCGGAGCACTGGATCTCGAGCCTCGCCGCCGCCAAGCGGTTCTACGCGGCGCAG
CTCGGTCACGTCGACGATATGGCGGGGATTGGAATGGAGGAGGTGGAGATGGAGATGGAG
GATGATGGCGAGGGCATGGAGCTGGAGCTGGAGATGCAGCTGGAGGAGGCGACGTGGCCG
GACGTGGCCTGCCCCTACTGCTACGAGGACCACGACATCGCGTCCCTCTGCGCCCACCTC
GAGGAGGACCACCCCTACGAGCCCCACACCTCGCCCTGTCCCATCTGCTTCGAAAAGATT
ACAAGAGATATGTTAAATCATATCACCATGCAACATGGTTACTTGTTCAAGAGTGGTCGC
AGGATGCGCAGATTCGATATTCCCGAGAGCCAGGCACTTTCTTTACTGAGCCGAGATCTG
CGGGATGCTCAGTTACAGGCACTTCTAGGAGGTGGTCATCGTCAGCGAAGAAGCAACACT
ACTGCCACAAACATTTCTGCTGATCCTCTGCTTTCTTCGTTTGGCCTGGGCTTCTCAACA
TTGGATTCAGAGGAACGATCAAAAGCACCAGTTCCTATTCCTGATGATACATCAATTCAT
AAGGATACTCCTGCTCAGCCATGGGAATCAAGGATCGACTCATCGCTCACGAGTGAGGAA
AGGGAACAAAAGCGGAAACAAGCCACTGACAGAGCAACCTTTGTGCAAGGCCTGGTGCTC
TCCACTTTATTTGAAGACTGA

Protein

247 aa

>Os01t0672400-04 Drought induced 19 family protein.
MDSEHWISSLAAAKRFYAAQLGHVDDMAGIGMEEVEMEMEDDGEGMELELEMQLEEATWP
DVACPYCYEDHDIASLCAHLEEDHPYEPHTSPCPICFEKITRDMLNHITMQHGYLFKSGR
RMRRFDIPESQALSLLSRDLRDAQLQALLGGGHRQRRSNTTATNISADPLLSSFGLGFST
LDSEERSKAPVPIPDDTSIHKDTPAQPWESRIDSSLTSEEREQKRKQATDRATFVQGLVL
STLFED*

5'UTR

chr01:27601815..27601866 (+ strand) : 52 bp

CDS

chr01:27601867..27601942 (+ strand) : 76 bp

chr01:27602040..27602236 (+ strand) : 197 bp

chr01:27603384..27603461 (+ strand) : 78 bp

chr01:27603578..27603858 (+ strand) : 281 bp

chr01:27604437..27604545 (+ strand) : 109 bp

3'UTR

chr01:27604546..27604909 (+ strand) : 364 bp

FASTA

>Os01t0672400-04 class=Sequence position=chr01:27601815..27604909 (+ strand)
AGCCTTAAGC TCGAACGCGG GGTGGTGGTT GTACCAGCAG CAGCAGGGAA TCATGGACTC GGAGCACTGG ATCTCGAGCC
TCGCCGCCGC CAAGCGGTTC TACGCGGCGC AGCTCGGTCA CGTCGACGGT ATGCGGCCAT CTCGACTTTT CCCTCGAATC
TTTGTTTGGC TTTCTGCTGT TGCTGTTGCT GATTTGTGAT TTGATTCGTT GGATTGGGCG CGCAGATATG GCGGGGATTG
GAATGGAGGA GGTGGAGATG GAGATGGAGG ATGATGGCGA GGGCATGGAG CTGGAGCTGG AGATGCAGCT GGAGGAGGCG
ACGTGGCCGG ACGTGGCCTG CCCCTACTGC TACGAGGACC ACGACATCGC GTCCCTCTGC GCCCACCTCG AGGAGGACCA
CCCCTACGAG CCCCACACCT CGGTGAGCTC CTCGCCGCCA TGCCCTGCGC CGCAGGGCTC CTTGCTCTGA CGCTCTGATG
ACATGACGCA CAAAGTCTGG CAAAGCTGCT CCTTTTGTTC GATTAGTAGG AACGCTGTAG CTTTAGGGGT TGACTTGGCG
AATGAACTCA ATATTTGGGC TACTTGTGGA GTTGCGGTAG TAGCAAACTT GCGGGGTATC TTCTTGAAAT AGCCAAAATT
CTTGAGATGA TAGTATTATG CAAAGCTCCT CTAGCCTTGA GTTCTTGCCT CTCTATGGCT TGGCTTGCAA TAGTTTGTGA
GCAAAGAGGT AGAATCTTTG GTATCTGTAT AGTATCAGTC AACTACGGAG CATAAGCTTA TGGATTCAGA ACTTGGCTGA
AAACACTAGC GATTTGGACC GGGAAATTGT GATTTTGTGA TTCGTAGGTA GGGAAGTTGT GTTGTAGTTT TAAGGGCAAG
GATAATTATA TATTTCTTAT AAGAACTGTA GATTATGCTT GACTGAAGGT TTTAAATCAG TAGCCAGCAT TGTTCACTTC
TGTAGTTGAC TGCTCTAGCT TGTAGTTGTG TGTTCTATTT CAAGGCCTAC TTCTGTAAAC AAGGTAGCTA ATTTCCTTTT
TATTTGATTG CCACTATAGT ACTTATGTCA CTGCGCCGAC TGTGCACCCT ACTCTTGGTG GACAGCTGCT CAGTTGTCAT
AAACTAAATG TTCATGAATA CCATGACTTA AAAACGTAAT CCTCTGTTAT TCATCTAACT TCAGCAACAG GAGTTGATTT
TGCAATGGCA CAAAATAACC TAGAAAAGTT AATGATGGTA ATGTGATTTA GATTTAAAAG ACTCGAACTG TTGTGTGGGG
TCCATTTTTA AGATTTGGAT TCATTTTATT CTAGTGAAAC AGAGGTGTTT GAGAATGCCA TATATATACT TTTAATGTTA
TAATCTCGTC TGAAGTTCGA GATGTTAACT GCAGAAATCC TAGAATCTGA AATAACCATT GTGCTTATTT GAATCTTTCG
CTAAGTTTAG TATCAAATAA GCACATTGGG TTCAAAGTAT ATTAAATCAG CACCTTATGT TCATATATTG TGCATATAAA
ATGTGCATTG TGTTCTTCTC CTGATTTATT TGCTTTGCTT TGCTTTCAGC CCTGTCCCAT CTGCTTCGAA AAGATTACAA
GAGATATGTT AAATCATATC ACCATGCAAC ATGGTTACTT GTTCAAGGTT AATCTCCTTC CATACCTATT CTGTTGCACA
AGCATATGCT AATTCTTTGA TAAATTTTCT TAATTATTTA GGAATGTTCT GATTCCTTTT TCAAAATTAT TTGTGATGTA
CAGAGTGGTC GCAGGATGCG CAGATTCGAT ATTCCCGAGA GCCAGGCACT TTCTTTACTG AGCCGAGATC TGCGGGATGC
TCAGTTACAG GCACTTCTAG GAGGTGGTCA TCGTCAGCGA AGAAGCAACA CTACTGCCAC AAACATTTCT GCTGATCCTC
TGCTTTCTTC GTTTGGCCTG GGCTTCTCAA CATTGGATTC AGAGGAACGA TCAAAAGCAC CAGTTCCTAT TCCTGATGAT
ACATCAATTC ATAAGGATAC TCCTGCTCAG CCATGGGAAT CAAGGTATAT ATATTTACAC TGCTCAGCCG AATCACATTA
GTGGCCTGAT ATTCTTCCAC CTAAAACCCC ACTACTAACA GCATTACTTC AAGAATCATC CTAGTTTGTC TGGAAAGCAT
AGCAAACACT ATTGAGTATT AGCCAATTAG TTCCCATGTC CTGCCATGCT CTATGATTTA TTTTTCAGCT AGCACTTTCA
CAAACTGTTC ACAGTTACCT TCTTGTCTGA GACAGGTACT GTCAATTTTG TTACATATGT CAGAAAGACT ATCAACCACC
AGTTAAACAG TTGTGTCCTT GTGATTTTTT AGACTGTTCA CTAGCTGTAC GCTTTTACAT TTGATGAAAA CAGTCCATAT
TATGTCAATG AATTGTTAAG TAGCTCTAAG ATTGACCATA TTCACAACTA TAAAGGTCTA CATAATACTT GCCGTTTCCC
CTAGCATTCA GATGGTCAGA CCAATTAGGT AAAGTAGAGC ATTCAGGTCT ATATATGTGC TCAGTTAGTA TGTTTCAAAC
CAGCAGCTTA TAAACTCCTT AAGAGATATG CAAATATGAA ATATTTATTT TTTCCATGGC AGGATCGACT CATCGCTCAC
GAGTGAGGAA AGGGAACAAA AGCGGAAACA AGCCACTGAC AGAGCAACCT TTGTGCAAGG CCTGGTGCTC TCCACTTTAT
TTGAAGACTG ACTGTTCAAG TAGCCCTAGT TTTTCTTGCT AGATGCATGT TTCCTCTCGC TGGTTCCCAT AAAAGCGCAA
TGTTCCACCT GATTTGGTGA ATCTGATTTC GTCAACAGTG AGATGGATGT GCTTCTGGTG CCCCGTTGTT CTTTCGCTTC
AGTAAAGCGC GAAGTTGATT TGGGCATGAT ACACACCTTA ATTTATGTCA GCTGCCCTGT ACCATTGCTT TTTATGAATT
AACGGGTAGC CACACCTTGA CTGTAACTCG TTGTTGTACC TCTCCATACT GTCTAGGAAC ATTGGTTTGT ACAAACATAA
AAGCTGTTAC ATGTTGTACA ATGCAAAGGC AAATGCAGAA GCACCGTTTA TATCG

Locus: Os01g0672400

Loading...

Locus: Os01g0672400

Loading...