Os01t0673600-01

Locus

Os01g0673600

Description

Ubiquitin-conjugating enzyme, Error-free DNA damage tolerance, Regulation of abiotic stress and hormone responses

RAP-DB Gene Symbol Synonym(s)

OsUbc13, Ubc13, OsUBC47, UBC47

RAP-DB Gene Name Synonym(s)

Ubiquitin conjugating enzyme 13, Ubiquitin-conjugating enzyme 47

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsUbc13, Ubc13, OsUBC47, UBC47

Oryzabase Gene Name Synonym(s)

Ubiquitin conjugating enzyme 13, Ubiquitin-conjugating enzyme 47

Transcript Evidence

AK122067

Protein Evidence

Q8W0I1

Literature

PMID: 25001222

PMID: 25902049

Note

Manual Curation

December 7, 2016

Functional domain (InterPro)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme E2 (IPR000608)

Ubiquitin-conjugating enzyme, active site (IPR023313)

Full-length cDNA

J033117D10 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0673600-01)

RiceXPro (AK122067)

Others

Oryzabase (18115)

KEGG (Os01t0673600-01 (EC:6.3.2.19))

Transcript

892 bp

>Os01t0673600-01 Ubiquitin-conjugating enzyme, Error-free DNA damage tolerance, Regulation of abiotic stress and hormone responses
CCCCGTTTCCCCCACCCTCGGCTGACGGCTCCTCCTCCTCCTCCTCCTCTTCCTCCCTCC
CGATCCCCTCCCCCGCACGAAACTCAAAGCATCCCCGGCGCCGCAGCTCCCCGGAGGAGG
AAGCCCCCGCGCCCCGCCCCGACCAGATCCGATGGCCAACAGCAACCTCCCCCGGCGAAT
CATCAAGGAGACGCAGCGACTCCTCAGCGAGCCAGCGCCGGGAATCAGCGCGTCTCCGTC
GGAGGAGAACATGCGCTACTTCAACGTCATGATCCTTGGCCCGGCACAGTCCCCCTATGA
AGGTGGAGTTTTTAAGCTTGAACTCTTTTTACCTGAGGAATATCCTATGGCTGCTCCAAA
GGTTAGGTTCCTGACCAAAATATACCACCCCAACATTGACAAGCTTGGTAGGATATGCCT
TGACATTCTCAAGGACAAATGGAGCCCAGCCCTTCAGATTCGGACAGTTCTTTTGAGTAT
CCAGGCACTCCTAAGTGCACCAAACCCTGATGATCCTCTCTCTGATAACATTGCAAAGCA
CTGGAAAGCCAATGAAGCAGAAGCTGTTGAAACAGCAAAGGAGTGGACTCGCCTGTATGC
CAGCGGTGCATAAAACCCAATGCCTCTCGTGATGTAATAACCCGTCATGCTTTAGCCTTA
ATCAAATGCCATTTGCTTGATAAGAACAAACTGGAGATATTGGCAGTGGAAGGGAGTTTA
AATGACTACCGCTTGAATTATTTGTCTGTATACATGTGGTTGGTTCCCTTTACCCTAGGG
CACCCTTGACTAATCAGTATCTGTGGTAGAACTTGGTGCTCCTCCAATATATTTATTACT
TTATGTTGGAAAACTTAAATTGTTGAAATTGGATCTTTGTTCGTGTGGCTGC

CDS

462 bp

>Os01t0673600-01 Ubiquitin-conjugating enzyme, Error-free DNA damage tolerance, Regulation of abiotic stress and hormone responses
ATGGCCAACAGCAACCTCCCCCGGCGAATCATCAAGGAGACGCAGCGACTCCTCAGCGAG
CCAGCGCCGGGAATCAGCGCGTCTCCGTCGGAGGAGAACATGCGCTACTTCAACGTCATG
ATCCTTGGCCCGGCACAGTCCCCCTATGAAGGTGGAGTTTTTAAGCTTGAACTCTTTTTA
CCTGAGGAATATCCTATGGCTGCTCCAAAGGTTAGGTTCCTGACCAAAATATACCACCCC
AACATTGACAAGCTTGGTAGGATATGCCTTGACATTCTCAAGGACAAATGGAGCCCAGCC
CTTCAGATTCGGACAGTTCTTTTGAGTATCCAGGCACTCCTAAGTGCACCAAACCCTGAT
GATCCTCTCTCTGATAACATTGCAAAGCACTGGAAAGCCAATGAAGCAGAAGCTGTTGAA
ACAGCAAAGGAGTGGACTCGCCTGTATGCCAGCGGTGCATAA

Protein

154 aa

>Os01t0673600-01 Ubiquitin-conjugating enzyme, Error-free DNA damage tolerance, Regulation of abiotic stress and hormone responses
MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFL
PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
DPLSDNIAKHWKANEAEAVETAKEWTRLYASGA*

5'UTR

chr01:27671461..27671611 (- strand) : 151 bp

CDS

chr01:27671425..27671460 (- strand) : 36 bp

chr01:27671243..27671270 (- strand) : 28 bp

chr01:27671042..27671128 (- strand) : 87 bp

chr01:27670333..27670391 (- strand) : 59 bp

chr01:27669502..27669543 (- strand) : 42 bp

chr01:27669349..27669422 (- strand) : 74 bp

chr01:27668993..27669090 (- strand) : 98 bp

chr01:27668864..27668901 (- strand) : 38 bp

3'UTR

chr01:27668585..27668863 (- strand) : 279 bp

FASTA

>Os01t0673600-01 class=Sequence position=chr01:27668585..27671611 (- strand)
CCCCGTTTCC CCCACCCTCG GCTGACGGCT CCTCCTCCTC CTCCTCCTCT TCCTCCCTCC CGATCCCCTC CCCCGCACGA
AACTCAAAGC ATCCCCGGCG CCGCAGCTCC CCGGAGGAGG AAGCCCCCGC GCCCCGCCCC GACCAGATCC GATGGCCAAC
AGCAACCTCC CCCGGCGAAT CATCAAGGTC GCGCCTCCGA TCTGATTGCC TGGGCGTAGA TCTCCCCACG CCTCTAACCC
GATTCCCCCC TTTTCTTTTC TTTTTTTTTT TATTTTCCCT TTCTGTGCTG ATTTTTTGTT TTTGCTGTCT GTGTGTTCGC
GTCTGGTTTG GATCTGCGCA GGAGACGCAG CGACTCCTCA GCGAGCCAGG TGCGGGCGGT TTTTTTTTTT TTTATGTATC
GCGGATTTTG GCGATGGTGT TGTGTTTTTC CGTGGTTTGG GTTCGTGTTG TTCTGATGGT TTTGGGTTGG TTTGTTTGTG
CAGCGCCGGG AATCAGCGCG TCTCCGTCGG AGGAGAACAT GCGCTACTTC AACGTCATGA TCCTTGGCCC GGCACAGTCC
CCCTATGAAG GTACGGCACC CGATGGATAC GTTATTTGTT GTAGAGGGTG TTACGGCTCC CGATGGATAT GTTATTTGTT
GTAGAGGGTG GTCGATTAGG GCGTTTCTAG GTATACCGCA GAATTGGGTG ATTCTGTATA AACCCAATTA CTAGAAGTGT
TAATTATGTG TCAGTCATGG ACGGGCACGC ATTTCGTAAG CCTGCTTTTG CTTGATTAGG CTGGTTCTTT TGCACTTACC
AGTTTTAGTT TCTCGGGCGG CGGGCACTTG CATGTTCTAT GTGTCTCATA TTCCCTTTCT AGTATGAAGT TAGTAATGCT
AAAACACTAG TGACTTTTAG CAATAATGTT CTAAACTCGG ATTATATACG TGACTTATAA GTGCTTTTCT TTTATGTGTT
AACTTGTTTG ATGCTTTGTG CGGCAAAGGT TGCCCTTGAT TTTCCATAAC CAAATTGATC TCTTCGATTT ATTTGATTAG
ACTAATTATG AGTATTGATA TTGTTGGCTT TTCATGTTGT GGTGTATAAT TTAAATATTT CCTTTCTTAA ACCCTTTTTG
CGTTAATTCG GGTTGGATAT ATAATGGGTG TTAACAGTTA GTAGCTTTAG ATGGTTTATT CTATTATCAT TTGGCTTCCT
GATATTGTTC TTTCTATCAG GTGGAGTTTT TAAGCTTGAA CTCTTTTTAC CTGAGGAATA TCCTATGGCT GCTCCAAAGG
TAACAAGACA TAGATAAACT TTGGTTATGT TTTATATGAT ATTATGGGGA CTGTATACCT TCAAGCTAAT TATGTCGTAT
TTAGAATTGC GTGTGGTTAT ATACTCATAT TAAAAGTCAG GACATTTCTG CATTCATTGA CTTGTGTTGT GAAGCGGAGC
ATTAATTTGG TGACATTGGA CTCATGCATA TAACCAAATA CAGGAAAGTA GCTGAAACAT TTAATTTGTT TGAACCATTC
TTTGGCAAAA AAAAATTTTT ATTCTTTATA GCCTAATTTT TAGTTACCCA TATTTAATCG TGTCGCTCTG GAACCATCGT
TGGTTTTATA TGTTATATGT GATGTCTTGT TGGTAATAGT TTTGTTACAT TTGCTTGATT TCCTTTTAGG GATAATGCAA
ACCCTGCCTA TTTGAGATGT AATTTGCAAT GAGATCCTGT GCCAAGGACC AAGGTTGTAA GATATACTTT TGGTCCTGTG
GGAACTTTTA GCTGTGTCCT GAGCATCAGC ACGCCATTGC TTCTCTTGAC CGTCTTTTTG CTTCAAGTTC TTAAAGGTGT
TCTTAACATC ACATTGTTCG TTTGGTGTTC AGCCAAATTA TACCTTGATT AGTTATTTTT TTAGTCTGTT TGGCTTGACA
ATGTCATAGA TTGGAAGGGT GAAGAAATAT TACTCATATG TTATACAACC ATACCGGATT ATTGTCTACT TCAGTCTCCC
TAAGTGTAAA GCTATATAAT TCATTATTGT CTACCTCAGT CTCCATTTTT TCTTTGTTGC GTATGCAGGT TAGGTTCCTG
ACCAAAATAT ACCACCCCAA CATTGACAAG GTTTGCAGTC ACATTCCTCT TTGTTATTTA GTTTACTTCG TAATACATTG
TTTATTCATT AATAGGTTTA CTTTTGTAGC TTGGTAGGAT ATGCCTTGAC ATTCTCAAGG ACAAATGGAG CCCAGCCCTT
CAGATTCGGA CAGTTCTTTT GAGGTCTCTC CCCCGTTGCC TGCACATGTG TATTAGCTTT TTATATCCTG CACAAATTCC
TTGTCTGCTA AGCTGTTGTC TTATTACGAT TGACATGATT TCTGTTGAAT TTGAATTATT TGTTAGCTTA CCTGCATTTA
GTAATTTTAT CACTGCCCTT GATGTGTTTT TCCAACAAAA ACTCTTGAGC ATTGTCAACT ATTGGAAGTT AGGGGTATCA
CTTTGCTATA CTTACCTTGT GACAACACTC TTTTTTTTCA GTATCCAGGC ACTCCTAAGT GCACCAAACC CTGATGATCC
TCTCTCTGAT AACATTGCAA AGCACTGGAA AGCCAATGAA GCAGAAGCTG TTGAAACAGG TAAATTGAAG CTAGCAATCC
AGTTAACAGT GTCTCCCCTC ACACTCTGAT TTTATTGGTT GCCTGATAAG CGATGGTCTG GCATTTGCAG CAAAGGAGTG
GACTCGCCTG TATGCCAGCG GTGCATAAAA CCCAATGCCT CTCGTGATGT AATAACCCGT CATGCTTTAG CCTTAATCAA
ATGCCATTTG CTTGATAAGA ACAAACTGGA GATATTGGCA GTGGAAGGGA GTTTAAATGA CTACCGCTTG AATTATTTGT
CTGTATACAT GTGGTTGGTT CCCTTTACCC TAGGGCACCC TTGACTAATC AGTATCTGTG GTAGAACTTG GTGCTCCTCC
AATATATTTA TTACTTTATG TTGGAAAACT TAAATTGTTG AAATTGGATC TTTGTTCGTG TGGCTGC

Locus: Os01g0673600

Loading...

Locus: Os01g0673600

Loading...