Os01t0675700-01

Locus

Os01g0675700

Description

Similar to Auxin-responsive protein IAA14 (Indoleacetic acid-induced protein 14) (SOLITARY-ROOT protein).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA5

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA5

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 5

Transcript Evidence

AK106121 (DDBJ, Best hit)

Protein Evidence

Q0JKG7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

001-207-E11 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0675700-01)

RiceXPro (AK106121)

Others

Oryzabase (10896)

KEGG (Os01t0675700-01)

Transcript

1231 bp

>Os01t0675700-01 Similar to Auxin-responsive protein IAA14 (Indoleacetic acid-induced protein 14) (SOLITARY-ROOT protein).
ATCCACCACACCACTTGCCTCCAAACAAAAATCTGACCTGACCTGACCTCCTCCTCGGCT
CCTCCTCCTCACCCACAACTCTTCCCAATGTCGCCTCCCCTCGAGCCGCACGACTACATC
GGCCTCTCCGCTGCGGCGGCGTCCCCGACGCCGAGCTCGTCGTCCTGCTCGTCCTCGCCG
AACCCAGGCGGCGAGGCCCGCGGCCCACGCCTCACGCTCCGCCTCGGCCTCCCGGGGTCG
GAGTCCCCCGAGCGGGAGGTCGTCGccgcggggctcaccctcgggcctctgcccccgacc
accaccaaggcggcctccaagcgcgccttccccgactcctccccgcggcacggcgccagc
tccggctccgtcgccgccgccgcagcttgccaggacaaggcggcccccgccGCCGCTCCG
CCGGCTGCAAAGGCGCAGGTGGTGGGATGGCCGCCCGTGCGGAACTACCGAAAGAACACG
CTGGCGGCGAGCGCCTCCAAGGGCAAAGGGGAGGACAAGGGCACGGCTGAAGGGGGCCCT
CTCTATGTCAAGGTGAGCATGGATGGAGCCCCCTACCTCAGGAAGGTCGACCTCAAGATG
TATTCTAGCTATGAGGACCTCTCCATGGCTCTCGAGAAGATGTTCAGCTGCTTCATCACT
GGTCAAAGCGGTTTGCGTAAATCATCAAACAGAGATAGGCTTACTAATGGTTCAAAGGCT
GATGCCCTCCAAGACCAAGAGTATGTCCTTACATATGAAGATAAGGATGCTGACTGGATG
CTTGTTGGTGATCTTCCTTGGGAtttgtttaccactatctgccggaaattgaaaatcatg
agaggatctgatgctgctggaatagCTCCAAGATCAATAGAGCAGTCAGGGCAGAGCAGA
TAAGATTAACCTTCGTCCGGACGAGAAAGGCAACTGATCTAGCAGCTTTGGAATTGTTCA
TCGCAAGTATCCCAAATATCTCAATGTCTGTGTAGTTTAATGTGTTCATCAGACCTGTGC
ATTGTATGTCTGTAATTTGTTCCTTTCAGATCGTGCAATTGTGCGTTGCCCCCTCTTTTC
TTTGCATTGAAGGTCAAGTCGGGCTCTTGTCCGCTTATTTCTCTAAATCCTAGTCAGTTC
AAAAATTATCCATCATGACACATGAACTGATGGTGGATAATATGGCAAGAAGCTTTTCTA
ATCATTCAAGCTTGAACCTCTTGTGTGTTCT

CDS

816 bp

>Os01t0675700-01 Similar to Auxin-responsive protein IAA14 (Indoleacetic acid-induced protein 14) (SOLITARY-ROOT protein).
ATGTCGCCTCCCCTCGAGCCGCACGACTACATCGGCCTCTCCGCTGCGGCGGCGTCCCCG
ACGCCGAGCTCGTCGTCCTGCTCGTCCTCGCCGAACCCAGGCGGCGAGGCCCGCGGCCCA
CGCCTCACGCTCCGCCTCGGCCTCCCGGGGTCGGAGTCCCCCGAGCGGGAGGTCGTCGcc
gcggggctcaccctcgggcctctgcccccgaccaccaccaaggcggcctccaagcgcgcc
ttccccgactcctccccgcggcacggcgccagctccggctccgtcgccgccgccgcagct
tgccaggacaaggcggcccccgccGCCGCTCCGCCGGCTGCAAAGGCGCAGGTGGTGGGA
TGGCCGCCCGTGCGGAACTACCGAAAGAACACGCTGGCGGCGAGCGCCTCCAAGGGCAAA
GGGGAGGACAAGGGCACGGCTGAAGGGGGCCCTCTCTATGTCAAGGTGAGCATGGATGGA
GCCCCCTACCTCAGGAAGGTCGACCTCAAGATGTATTCTAGCTATGAGGACCTCTCCATG
GCTCTCGAGAAGATGTTCAGCTGCTTCATCACTGGTCAAAGCGGTTTGCGTAAATCATCA
AACAGAGATAGGCTTACTAATGGTTCAAAGGCTGATGCCCTCCAAGACCAAGAGTATGTC
CTTACATATGAAGATAAGGATGCTGACTGGATGCTTGTTGGTGATCTTCCTTGGGAtttg
tttaccactatctgccggaaattgaaaatcatgagaggatctgatgctgctggaatagCT
CCAAGATCAATAGAGCAGTCAGGGCAGAGCAGATAA

Protein

272 aa

>Os01t0675700-01 Similar to Auxin-responsive protein IAA14 (Indoleacetic acid-induced protein 14) (SOLITARY-ROOT protein).
MSPPLEPHDYIGLSAAAASPTPSSSSCSSSPNPGGEARGPRLTLRLGLPGSESPEREVVA
AGLTLGPLPPTTTKAASKRAFPDSSPRHGASSGSVAAAAACQDKAAPAAAPPAAKAQVVG
WPPVRNYRKNTLAASASKGKGEDKGTAEGGPLYVKVSMDGAPYLRKVDLKMYSSYEDLSM
ALEKMFSCFITGQSGLRKSSNRDRLTNGSKADALQDQEYVLTYEDKDADWMLVGDLPWDL
FTTICRKLKIMRGSDAAGIAPRSIEQSGQSR*

5'UTR

chr01:27777432..27777518 (+ strand) : 87 bp

CDS

chr01:27777519..27777862 (+ strand) : 344 bp

chr01:27777951..27778180 (+ strand) : 230 bp

chr01:27778693..27778834 (+ strand) : 142 bp

chr01:27780188..27780249 (+ strand) : 62 bp

chr01:27780630..27780667 (+ strand) : 38 bp

3'UTR

chr01:27780668..27780995 (+ strand) : 328 bp

FASTA

>Os01t0675700-01 class=Sequence position=chr01:27777432..27780995 (+ strand)
ATCCACCACA CCACTTGCCT CCAAACAAAA ATCTGACCTG ACCTGACCTC CTCCTCGGCT CCTCCTCCTC ACCCACAACT
CTTCCCAATG TCGCCTCCCC TCGAGCCGCA CGACTACATC GGCCTCTCCG CTGCGGCGGC GTCCCCGACG CCGAGCTCGT
CGTCCTGCTC GTCCTCGCCG AACCCAGGCG GCGAGGCCCG CGGCCCACGC CTCACGCTCC GCCTCGGCCT CCCGGGGTCG
GAGTCCCCCG AGCGGGAGGT CGTCGccgcg gggctcaccc tcgggcctct gcccccgacc accaccaagg cggcctccaa
gcgcgccttc cccgactcct ccccgcggca cggcgccagc tccggctccg tcgccgccgc cgcagcttgc caggacaagg
cggcccccgc cGCCGCTCCG CCGGCTGCAA AGTAAGATTC GTGAGATTCG ATGTGGGGCG GGTGTGTGTG CGTGTGCTGC
CGTGCTGGTA CTGATCGGCG ATGGCGATGT GGAGCCCAGG GCGCAGGTGG TGGGATGGCC GCCCGTGCGG AACTACCGAA
AGAACACGCT GGCGGCGAGC GCCTCCAAGG GCAAAGGGGA GGACAAGGGC ACGGCTGAAG GGGGCCCTCT CTATGTCAAG
GTGAGCATGG ATGGAGCCCC CTACCTCAGG AAGGTCGACC TCAAGATGTA TTCTAGCTAT GAGGACCTCT CCATGGCTCT
CGAGAAGATG TTCAGCTGCT TCATCACTGG TGAGCACCCG CCTCAAAGAT TCTCTCCGAT GTGTGTCTTG CTCGTAAAAT
ACACCATTTT AGCTGGTGGG AGTGTGCGAA AGCATGCCAC TGACATTTTA AGAATGGAAA TCTGATCCAA TGCCTGAAGT
GTGCATAGGG TTGACAGATT TAGCTGTAAA CTCTGAAGGG AAATTATAAA CCTGTCCTTG CAAGTTACCC TGATATTCGT
CATGGTACAA TCTAGTACCA ATCAGTTTGG CTCCTTAGCT CAATTGCTAG TCAACCTTTC CATAGCTTAA TGATAATGGA
ACCACAGTAT TTAGACAATG CCATGGTTGA TGGTTCTCAG GGTTAAAGTA TGAATATTTG AGATGCAAAT TATTCCATAC
AACAGTTTGA GCTGTTCATT GCATAGTGCT CAATAGTTCT AACCTCTTTT TTGTGTTCAA TAGCAACTAC GTTCCCATCT
GTATATGCTG GTGAGCTTTT GCTTTTGTGA TGGTGCTTAT ACCATGCCTA TGATTTTAAA GGTCAAAGCG GTTTGCGTAA
ATCATCAAAC AGAGATAGGC TTACTAATGG TTCAAAGGCT GATGCCCTCC AAGACCAAGA GTATGTCCTT ACATATGAAG
ATAAGGATGC TGACTGGATG CTTGTTGGTG ATCTTCCTTG GGAGTAAGTT TCTGGCATTT TATATCCATT TTGCTTTTTT
TTTTTTTTAA AAGCACCGCA TGTTATGTTG TGTTATTGTA CCATGTACAT ACTTTTGCTG ATGTCCCTTT GTTTCACCTG
TTCTACCAGT ATGGGTGGCT TATGTACAAA ACTTGTATTT CAATATTGTA TTGTAGATCG AAGCAGGACT AGTTAGAGTT
TTTTTTTTTA CCATGAACAG CACTAGTTGG ATCGATTTCT TAAAATGCTA TGTGGCTGAT CAATAAAATA TTGTGATCCG
TATATTTGAT TAACTAACCG TTCACTGTTA GGAACACCAT CTTTTCCTTT AGAATACATT GCTTTTATAG AACCAATAGT
TCAGTAACAT ATAAATAACC TTTTATGGGT TATATTTTTT AAAATTCAGT ACTGATCTTA ATGCAAATGA AGGGTCTAAA
TTACATCTAC TTATTGCATA ATTTTTCAAA GAGTAAACTT CTCATTTTCT TTCCCTTGCA TTAATTTATT GGGCTAGGCA
TATGATGTGT TAATCTGTTA CCTGCCCCAA TGTTCGGGCT GACCATTTTG AGACATTATT CTGTACTGAA CTTCAAACCG
AGCTCTGCAC ATTATTAGTT TTGATAGCAT TGACCATAAA CAAATGTAGG GGACATTGGA TGAACTATGA ACGTAGCTTA
GATTTAATGA TTTTCCCAAA CTAATATCCA CAacctgagg ccataacagg ataaaccccg ccaggaggat actagggaag
agatgtagat ttagactagg gaagaagaac attgagggag agcttagatt aactttgatt cattattcat tgcttaaccc
tgaatcagga tacaattcat ccgcatatag atagAGGGAA GGACCAGTCT AACATTTAAT CCATGTACCT ATCTAACAGT
CTCTAACCAA CTGAGCTACA TTACGGTTAT AAGTTATGGG TTGAATTACC GTATTACTGT TACAGGTGAG GTGAGGATAG
GGTTACTCGA CCGGTACTGG TTGTTATCCT TTGAGCCTTA GCCTCTCGGC CCAATGACAC TAATCACTAA TTTTGATTCA
AGATTACAGA CCTTCTATAT TGTGCTGAGT ACTAACAGCA GAAGCAAAAA CTTCCTTGTT CTTAATTATA CCATACAACC
ATGAAGATAT CCCATAGATA TGCCACTTCA CTTAAACCGA CCTTAAAATT CTATATTGTC GGTACAGAAT AAATTTCCTA
ACATCTAGTC TATTAATTTG CTGGATTCCT TAGCCTTCAT ATTGCTGTAA GTTCCATACA GAGCAGGATA ttaggtactc
ttgaaagatt tctaacttta gattgttcat ttgcagtttg tttaccacta tctgccggaa attgaaaatc atgagaggat
ctgatgctgc tggaataggt atTTGCACTC TGCACAAATA TGTAATTAGT ATGGAATATG CCTGCAATTG AACTGAATGC
TTCACTGGAA ATTTAATTCG CAAACTAAGA AATCAGTGTT AGCTGTAATG GATGGAGCCC AAGATCTGCT TTCTAGTACC
ACATTATATA GCTCAGATGA TGCTTTCATG TATGGATAAT TTAGCTCTTG TCTGACTTAG TGAAGCATAA ATCTAAGCCA
ATTATTGTGA TGGTAGCTGG AGTCCCTCTG CAAATAACAC TTTACACCAC TCGCAATGAA TTTGCCTGAT TTTGAACAGC
ATGTGTGTGT ACTTCATTAA GAAGTACCTT TGGCTAGCAG TTGTGCTTTT GATCTGAAAT ACATCCATCT GTTTGCAGCT
CCAAGATCAA TAGAGCAGTC AGGGCAGAGC AGATAAGATT AACCTTCGTC CGGACGAGAA AGGCAACTGA TCTAGCAGCT
TTGGAATTGT TCATCGCAAG TATCCCAAAT ATCTCAATGT CTGTGTAGTT TAATGTGTTC ATCAGACCTG TGCATTGTAT
GTCTGTAATT TGTTCCTTTC AGATCGTGCA ATTGTGCGTT GCCCCCTCTT TTCTTTGCAT TGAAGGTCAA GTCGGGCTCT
TGTCCGCTTA TTTCTCTAAA TCCTAGTCAG TTCAAAAATT ATCCATCATG ACACATGAAC TGATGGTGGA TAATATGGCA
AGAAGCTTTT CTAATCATTC AAGCTTGAAC CTCTTGTGTG TTCT

Locus: Os01g0675700

Loading...

Locus: Os01g0675700

Loading...