Os01t0675700-02

Locus

Os01g0675700

Description

Similar to Auxin-responsive protein IAA14 (Indoleacetic acid-induced protein 14) (SOLITARY-ROOT protein).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA5

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA5

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 5

Transcript Evidence

AK061495 (DDBJ, Best hit)

AK102396 (DDBJ, Best hit)

Protein Evidence

Q0JKG7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

006-309-C06 (Online Clone Ordering)

J033092H03 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0675700-02)

Others

Oryzabase (10896)

Transcript

1140 bp

>Os01t0675700-02 Similar to Auxin-responsive protein IAA14 (Indoleacetic acid-induced protein 14) (SOLITARY-ROOT protein).
ACAACTCTTCCCAATGTCGCCTCCCCTCGAGCCGCACGACTACATCGGCCTCTCCGCTGC
GGCGGCGTCCCCGACGCCGAGCTCGTCGTCCTGCTCGTCCTCGCCGAACCCAGGCGGCGA
GGCCCGCGGCCCACGCCTCACGCTCCGCCTCGGCCTCCCGGGGTCGGAGTCCCCCGAGCG
GGAGGTCGTCGccgcggggctcaccctcgggcctctgcccccgaccaccaccaaggcggc
ctccaagcgcgccttccccgactcctccccgcggcacggcgccagctccggctccgtcgc
cgccgccgcagcttgccaggacaaggcggcccccgccGCCGCTCCGCCGGCTGCAAAGGC
GCAGGTGGTGGGATGGCCGCCCGTGCGGAACTACCGAAAGAACACGCTGGCGGCGAGCGC
CTCCAAGGGCAAAGGGGAGGACAAGGGCACGGCTGAAGGGGGCCCTCTCTATGTCAAGGT
GAGCATGGATGGAGCCCCCTACCTCAGGAAGGTCGACCTCAAGATGTATTCTAGCTATGA
GGACCTCTCCATGGCTCTCGAGAAGATGTTCAGCTGCTTCATCACTGGTCAAAGCGGTTT
GCGTAAATCATCAAACAGAGATAGGCTTACTAATGGTTCAAAGGCTGATGCCCTCCAAGA
CCAAGAGTATGTCCTTACATATGAAGATAAGGATGCTGACTGGATGCTTGTTGGTGATCT
TCCTTGGGAtttgtttaccactatctgccggaaattgaaaatcatgagaggatctgatgc
tgctggaatagCTCCAAGATCAATAGAGCAGTCAGGGCAGAGCAGATAAGATTAACCTTC
GTCCGGACGAGAAAGGCAACTGATCTAGCAGCTTTGGAATTGTTCATCGCAAGTATCCCA
AATATCTCAATGTCTGTGTAGTTTAATGTGTTCATCAGACCTGTGCATTGTATGTCTGTA
ATTTGTTCCTTTCAGATCGTGCAATTGTGCGTTGCCCCCTCTTTTCTTTGCATTGAAGGT
CAAGTCGGGCTCTTGTCCGCTTATTTCTCTAAATCCTAGTCAGTTCAAAAATTATCCATC
ATGACACATGAACTGATGGTGGATAATATGGCAAGAAGCTTTTCTAATCATTCAAGCTTG

CDS

816 bp

>Os01t0675700-02 Similar to Auxin-responsive protein IAA14 (Indoleacetic acid-induced protein 14) (SOLITARY-ROOT protein).
ATGTCGCCTCCCCTCGAGCCGCACGACTACATCGGCCTCTCCGCTGCGGCGGCGTCCCCG
ACGCCGAGCTCGTCGTCCTGCTCGTCCTCGCCGAACCCAGGCGGCGAGGCCCGCGGCCCA
CGCCTCACGCTCCGCCTCGGCCTCCCGGGGTCGGAGTCCCCCGAGCGGGAGGTCGTCGcc
gcggggctcaccctcgggcctctgcccccgaccaccaccaaggcggcctccaagcgcgcc
ttccccgactcctccccgcggcacggcgccagctccggctccgtcgccgccgccgcagct
tgccaggacaaggcggcccccgccGCCGCTCCGCCGGCTGCAAAGGCGCAGGTGGTGGGA
TGGCCGCCCGTGCGGAACTACCGAAAGAACACGCTGGCGGCGAGCGCCTCCAAGGGCAAA
GGGGAGGACAAGGGCACGGCTGAAGGGGGCCCTCTCTATGTCAAGGTGAGCATGGATGGA
GCCCCCTACCTCAGGAAGGTCGACCTCAAGATGTATTCTAGCTATGAGGACCTCTCCATG
GCTCTCGAGAAGATGTTCAGCTGCTTCATCACTGGTCAAAGCGGTTTGCGTAAATCATCA
AACAGAGATAGGCTTACTAATGGTTCAAAGGCTGATGCCCTCCAAGACCAAGAGTATGTC
CTTACATATGAAGATAAGGATGCTGACTGGATGCTTGTTGGTGATCTTCCTTGGGAtttg
tttaccactatctgccggaaattgaaaatcatgagaggatctgatgctgctggaatagCT
CCAAGATCAATAGAGCAGTCAGGGCAGAGCAGATAA

Protein

272 aa

>Os01t0675700-02 Similar to Auxin-responsive protein IAA14 (Indoleacetic acid-induced protein 14) (SOLITARY-ROOT protein).
MSPPLEPHDYIGLSAAAASPTPSSSSCSSSPNPGGEARGPRLTLRLGLPGSESPEREVVA
AGLTLGPLPPTTTKAASKRAFPDSSPRHGASSGSVAAAAACQDKAAPAAAPPAAKAQVVG
WPPVRNYRKNTLAASASKGKGEDKGTAEGGPLYVKVSMDGAPYLRKVDLKMYSSYEDLSM
ALEKMFSCFITGQSGLRKSSNRDRLTNGSKADALQDQEYVLTYEDKDADWMLVGDLPWDL
FTTICRKLKIMRGSDAAGIAPRSIEQSGQSR*

5'UTR

chr01:27777506..27777518 (+ strand) : 13 bp

CDS

chr01:27777519..27777862 (+ strand) : 344 bp

chr01:27777951..27778180 (+ strand) : 230 bp

chr01:27778693..27778834 (+ strand) : 142 bp

chr01:27780188..27780249 (+ strand) : 62 bp

chr01:27780630..27780667 (+ strand) : 38 bp

3'UTR

chr01:27780668..27780978 (+ strand) : 311 bp

FASTA

>Os01t0675700-02 class=Sequence position=chr01:27777506..27780978 (+ strand)
ACAACTCTTC CCAATGTCGC CTCCCCTCGA GCCGCACGAC TACATCGGCC TCTCCGCTGC GGCGGCGTCC CCGACGCCGA
GCTCGTCGTC CTGCTCGTCC TCGCCGAACC CAGGCGGCGA GGCCCGCGGC CCACGCCTCA CGCTCCGCCT CGGCCTCCCG
GGGTCGGAGT CCCCCGAGCG GGAGGTCGTC Gccgcggggc tcaccctcgg gcctctgccc ccgaccacca ccaaggcggc
ctccaagcgc gccttccccg actcctcccc gcggcacggc gccagctccg gctccgtcgc cgccgccgca gcttgccagg
acaaggcggc ccccgccGCC GCTCCGCCGG CTGCAAAGTA AGATTCGTGA GATTCGATGT GGGGCGGGTG TGTGTGCGTG
TGCTGCCGTG CTGGTACTGA TCGGCGATGG CGATGTGGAG CCCAGGGCGC AGGTGGTGGG ATGGCCGCCC GTGCGGAACT
ACCGAAAGAA CACGCTGGCG GCGAGCGCCT CCAAGGGCAA AGGGGAGGAC AAGGGCACGG CTGAAGGGGG CCCTCTCTAT
GTCAAGGTGA GCATGGATGG AGCCCCCTAC CTCAGGAAGG TCGACCTCAA GATGTATTCT AGCTATGAGG ACCTCTCCAT
GGCTCTCGAG AAGATGTTCA GCTGCTTCAT CACTGGTGAG CACCCGCCTC AAAGATTCTC TCCGATGTGT GTCTTGCTCG
TAAAATACAC CATTTTAGCT GGTGGGAGTG TGCGAAAGCA TGCCACTGAC ATTTTAAGAA TGGAAATCTG ATCCAATGCC
TGAAGTGTGC ATAGGGTTGA CAGATTTAGC TGTAAACTCT GAAGGGAAAT TATAAACCTG TCCTTGCAAG TTACCCTGAT
ATTCGTCATG GTACAATCTA GTACCAATCA GTTTGGCTCC TTAGCTCAAT TGCTAGTCAA CCTTTCCATA GCTTAATGAT
AATGGAACCA CAGTATTTAG ACAATGCCAT GGTTGATGGT TCTCAGGGTT AAAGTATGAA TATTTGAGAT GCAAATTATT
CCATACAACA GTTTGAGCTG TTCATTGCAT AGTGCTCAAT AGTTCTAACC TCTTTTTTGT GTTCAATAGC AACTACGTTC
CCATCTGTAT ATGCTGGTGA GCTTTTGCTT TTGTGATGGT GCTTATACCA TGCCTATGAT TTTAAAGGTC AAAGCGGTTT
GCGTAAATCA TCAAACAGAG ATAGGCTTAC TAATGGTTCA AAGGCTGATG CCCTCCAAGA CCAAGAGTAT GTCCTTACAT
ATGAAGATAA GGATGCTGAC TGGATGCTTG TTGGTGATCT TCCTTGGGAG TAAGTTTCTG GCATTTTATA TCCATTTTGC
TTTTTTTTTT TTTTAAAAGC ACCGCATGTT ATGTTGTGTT ATTGTACCAT GTACATACTT TTGCTGATGT CCCTTTGTTT
CACCTGTTCT ACCAGTATGG GTGGCTTATG TACAAAACTT GTATTTCAAT ATTGTATTGT AGATCGAAGC AGGACTAGTT
AGAGTTTTTT TTTTTACCAT GAACAGCACT AGTTGGATCG ATTTCTTAAA ATGCTATGTG GCTGATCAAT AAAATATTGT
GATCCGTATA TTTGATTAAC TAACCGTTCA CTGTTAGGAA CACCATCTTT TCCTTTAGAA TACATTGCTT TTATAGAACC
AATAGTTCAG TAACATATAA ATAACCTTTT ATGGGTTATA TTTTTTAAAA TTCAGTACTG ATCTTAATGC AAATGAAGGG
TCTAAATTAC ATCTACTTAT TGCATAATTT TTCAAAGAGT AAACTTCTCA TTTTCTTTCC CTTGCATTAA TTTATTGGGC
TAGGCATATG ATGTGTTAAT CTGTTACCTG CCCCAATGTT CGGGCTGACC ATTTTGAGAC ATTATTCTGT ACTGAACTTC
AAACCGAGCT CTGCACATTA TTAGTTTTGA TAGCATTGAC CATAAACAAA TGTAGGGGAC ATTGGATGAA CTATGAACGT
AGCTTAGATT TAATGATTTT CCCAAACTAA TATCCACAac ctgaggccat aacaggataa accccgccag gaggatacta
gggaagagat gtagatttag actagggaag aagaacattg agggagagct tagattaact ttgattcatt attcattgct
taaccctgaa tcaggataca attcatccgc atatagatag AGGGAAGGAC CAGTCTAACA TTTAATCCAT GTACCTATCT
AACAGTCTCT AACCAACTGA GCTACATTAC GGTTATAAGT TATGGGTTGA ATTACCGTAT TACTGTTACA GGTGAGGTGA
GGATAGGGTT ACTCGACCGG TACTGGTTGT TATCCTTTGA GCCTTAGCCT CTCGGCCCAA TGACACTAAT CACTAATTTT
GATTCAAGAT TACAGACCTT CTATATTGTG CTGAGTACTA ACAGCAGAAG CAAAAACTTC CTTGTTCTTA ATTATACCAT
ACAACCATGA AGATATCCCA TAGATATGCC ACTTCACTTA AACCGACCTT AAAATTCTAT ATTGTCGGTA CAGAATAAAT
TTCCTAACAT CTAGTCTATT AATTTGCTGG ATTCCTTAGC CTTCATATTG CTGTAAGTTC CATACAGAGC AGGATAttag
gtactcttga aagatttcta actttagatt gttcatttgc agtttgttta ccactatctg ccggaaattg aaaatcatga
gaggatctga tgctgctgga ataggtatTT GCACTCTGCA CAAATATGTA ATTAGTATGG AATATGCCTG CAATTGAACT
GAATGCTTCA CTGGAAATTT AATTCGCAAA CTAAGAAATC AGTGTTAGCT GTAATGGATG GAGCCCAAGA TCTGCTTTCT
AGTACCACAT TATATAGCTC AGATGATGCT TTCATGTATG GATAATTTAG CTCTTGTCTG ACTTAGTGAA GCATAAATCT
AAGCCAATTA TTGTGATGGT AGCTGGAGTC CCTCTGCAAA TAACACTTTA CACCACTCGC AATGAATTTG CCTGATTTTG
AACAGCATGT GTGTGTACTT CATTAAGAAG TACCTTTGGC TAGCAGTTGT GCTTTTGATC TGAAATACAT CCATCTGTTT
GCAGCTCCAA GATCAATAGA GCAGTCAGGG CAGAGCAGAT AAGATTAACC TTCGTCCGGA CGAGAAAGGC AACTGATCTA
GCAGCTTTGG AATTGTTCAT CGCAAGTATC CCAAATATCT CAATGTCTGT GTAGTTTAAT GTGTTCATCA GACCTGTGCA
TTGTATGTCT GTAATTTGTT CCTTTCAGAT CGTGCAATTG TGCGTTGCCC CCTCTTTTCT TTGCATTGAA GGTCAAGTCG
GGCTCTTGTC CGCTTATTTC TCTAAATCCT AGTCAGTTCA AAAATTATCC ATCATGACAC ATGAACTGAT GGTGGATAAT
ATGGCAAGAA GCTTTTCTAA TCATTCAAGC TTG

Locus: Os01g0675700

Loading...

Locus: Os01g0675700

Loading...