Os01t0675800-01

Locus

Os01g0675800

Description

"NAM, ATAF1-2, and CUC2 (NAC) transcription factor", Drought tolerance

RAP-DB Gene Symbol Synonym(s)

OsNAC14

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC14

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 14

Oryzabase Gene Symbol Synonym(s)

ONAC014, ONAC14, OsNAC14, NAC14

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 014, NAC domain-containing protein 14

Transcript Evidence

AK105493

Protein Evidence

Q8LQP7

Literature

PMID: 29593766

Note

Manual Curation

June 19, 2020

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

NAC domain superfamily (IPR036093)

NAC domain (IPR003441)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

001-127-C03 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0675800-01)

RiceXPro (AK105493)

Others

Oryzabase (11464)

KEGG (Os01t0675800-01)

Transcript

1318 bp

>Os01t0675800-01 "NAM, ATAF1-2, and CUC2 (NAC) transcription factor", Drought tolerance
ATTCTTACCCCGACGCGGCGTCTCCTCCCCTCTCCTCTCCCCTTCCCTCCATCGCATCTC
CTCCCGCTCCTTCGATCCCAAATCGGCCGCCGCCGCCGCTCCGCCATGTCCCCCTCCCGC
CCCGACGAGGCGGACCCCGCCGCCGACTTCGGCTCCCACCCCACCGACCAAGAGCTCGTC
ACCAAATACCTACgccgccacgtcgactccggcgggaacccgtggcggtacgtccacgag
gccgacgtgtacgccgccgatcccgacgacctcaccggcaagtactccccggccgtcgcc
agcgacgggtccagggcgtggtacttcttcaccaccgtgcggtccaagagcaccggcggg
cagaggagggcgcgggccgtgggcgacggcgggtgctggcactccgaggccggcgccaag
gacgtcgtcggaggcATCCGCAGCCCCCGCCCGATAGGGCGGCGCCAGTTCTTCTCGTTC
GTCAACAAGGAGGGCCCCCGGCGGGTGCGGTCGGGGTGGATCATGGTCGAGATCGGCCTC
AAATACGCCCAGCAGAACGCCTCCTCCGACGAGCTTGTTCTGTGTAAGGTGTACCGGAGC
CCGCGGGCGCCACCGGCTGCCGCCGCCGCCAACAAATCCATGGCCGCCCCACCTCCCACC
GCCACGAAATCCAAGACGGAGGAGGCTACACCACCTCCCGATGACGTGAAACCGGTGGTG
GCGGCTGCGCAGACTCCCGACACCAAAATACTCAGGGCGGCGAAGGAGGCGGCCGCGACT
GGATGCAAGAGGAAGGCCGACGTGAAGAGCTCTGGTGCAAGAAGGGGCAAGCGGCTCTGC
TCCCGCTGCCGGGCGGAGACATCGGAATCGGACAGCGAGACGGCGGTACTTGACAGGTCG
CCGTCCATCGAAGACGAAACGGCGGACTCTTCAGAAATCCATGGAAGCAGTGATGGCAAA
TTCATCAGGTTCTTGTGATTTAGTTCGATCTGGAGCCCCGAGGGTGCTAGCCTAGATTGG
AATCAGCGTGTACCAACAAAATGGATAGAGCTGCTGTAGTTCTCATTTTGAGTTCTTAAG
CCCTAGTATAATGCCTACCCCAAATCATGCGTTACCCGCAAATTTCAGCATGATACAGAC
AAGGTAAGCATTTATTTTCAGTATCAGTTGCACCGTATGGTGCACTTGTAGATAGAAGTT
ACTACAGCATGGAGAAATTTGGAGATTAACATATAGACATTAGACATTTTCTTTCATGTA
ATATAGTAGTAGAACACACAAGAGGTTCAAGCTTGAATGATTAGAAAAGCTTCTTGCC

CDS

873 bp

>Os01t0675800-01 "NAM, ATAF1-2, and CUC2 (NAC) transcription factor", Drought tolerance
ATGTCCCCCTCCCGCCCCGACGAGGCGGACCCCGCCGCCGACTTCGGCTCCCACCCCACC
GACCAAGAGCTCGTCACCAAATACCTACgccgccacgtcgactccggcgggaacccgtgg
cggtacgtccacgaggccgacgtgtacgccgccgatcccgacgacctcaccggcaagtac
tccccggccgtcgccagcgacgggtccagggcgtggtacttcttcaccaccgtgcggtcc
aagagcaccggcgggcagaggagggcgcgggccgtgggcgacggcgggtgctggcactcc
gaggccggcgccaaggacgtcgtcggaggcATCCGCAGCCCCCGCCCGATAGGGCGGCGC
CAGTTCTTCTCGTTCGTCAACAAGGAGGGCCCCCGGCGGGTGCGGTCGGGGTGGATCATG
GTCGAGATCGGCCTCAAATACGCCCAGCAGAACGCCTCCTCCGACGAGCTTGTTCTGTGT
AAGGTGTACCGGAGCCCGCGGGCGCCACCGGCTGCCGCCGCCGCCAACAAATCCATGGCC
GCCCCACCTCCCACCGCCACGAAATCCAAGACGGAGGAGGCTACACCACCTCCCGATGAC
GTGAAACCGGTGGTGGCGGCTGCGCAGACTCCCGACACCAAAATACTCAGGGCGGCGAAG
GAGGCGGCCGCGACTGGATGCAAGAGGAAGGCCGACGTGAAGAGCTCTGGTGCAAGAAGG
GGCAAGCGGCTCTGCTCCCGCTGCCGGGCGGAGACATCGGAATCGGACAGCGAGACGGCG
GTACTTGACAGGTCGCCGTCCATCGAAGACGAAACGGCGGACTCTTCAGAAATCCATGGA
AGCAGTGATGGCAAATTCATCAGGTTCTTGTGA

Protein

291 aa

>Os01t0675800-01 "NAM, ATAF1-2, and CUC2 (NAC) transcription factor", Drought tolerance
MSPSRPDEADPAADFGSHPTDQELVTKYLRRHVDSGGNPWRYVHEADVYAADPDDLTGKY
SPAVASDGSRAWYFFTTVRSKSTGGQRRARAVGDGGCWHSEAGAKDVVGGIRSPRPIGRR
QFFSFVNKEGPRRVRSGWIMVEIGLKYAQQNASSDELVLCKVYRSPRAPPAAAAANKSMA
APPPTATKSKTEEATPPPDDVKPVVAAAQTPDTKILRAAKEAAATGCKRKADVKSSGARR
GKRLCSRCRAETSESDSETAVLDRSPSIEDETADSSEIHGSSDGKFIRFL*

5'UTR

chr01:27782161..27782265 (- strand) : 105 bp

CDS

chr01:27781288..27782160 (- strand) : 873 bp

3'UTR

chr01:27780948..27781287 (- strand) : 340 bp

FASTA

>Os01t0675800-01 class=Sequence position=chr01:27780948..27782265 (- strand)
ATTCTTACCC CGACGCGGCG TCTCCTCCCC TCTCCTCTCC CCTTCCCTCC ATCGCATCTC CTCCCGCTCC TTCGATCCCA
AATCGGCCGC CGCCGCCGCT CCGCCATGTC CCCCTCCCGC CCCGACGAGG CGGACCCCGC CGCCGACTTC GGCTCCCACC
CCACCGACCA AGAGCTCGTC ACCAAATACC TACgccgcca cgtcgactcc ggcgggaacc cgtggcggta cgtccacgag
gccgacgtgt acgccgccga tcccgacgac ctcaccggca agtactcccc ggccgtcgcc agcgacgggt ccagggcgtg
gtacttcttc accaccgtgc ggtccaagag caccggcggg cagaggaggg cgcgggccgt gggcgacggc gggtgctggc
actccgaggc cggcgccaag gacgtcgtcg gaggcATCCG CAGCCCCCGC CCGATAGGGC GGCGCCAGTT CTTCTCGTTC
GTCAACAAGG AGGGCCCCCG GCGGGTGCGG TCGGGGTGGA TCATGGTCGA GATCGGCCTC AAATACGCCC AGCAGAACGC
CTCCTCCGAC GAGCTTGTTC TGTGTAAGGT GTACCGGAGC CCGCGGGCGC CACCGGCTGC CGCCGCCGCC AACAAATCCA
TGGCCGCCCC ACCTCCCACC GCCACGAAAT CCAAGACGGA GGAGGCTACA CCACCTCCCG ATGACGTGAA ACCGGTGGTG
GCGGCTGCGC AGACTCCCGA CACCAAAATA CTCAGGGCGG CGAAGGAGGC GGCCGCGACT GGATGCAAGA GGAAGGCCGA
CGTGAAGAGC TCTGGTGCAA GAAGGGGCAA GCGGCTCTGC TCCCGCTGCC GGGCGGAGAC ATCGGAATCG GACAGCGAGA
CGGCGGTACT TGACAGGTCG CCGTCCATCG AAGACGAAAC GGCGGACTCT TCAGAAATCC ATGGAAGCAG TGATGGCAAA
TTCATCAGGT TCTTGTGATT TAGTTCGATC TGGAGCCCCG AGGGTGCTAG CCTAGATTGG AATCAGCGTG TACCAACAAA
ATGGATAGAG CTGCTGTAGT TCTCATTTTG AGTTCTTAAG CCCTAGTATA ATGCCTACCC CAAATCATGC GTTACCCGCA
AATTTCAGCA TGATACAGAC AAGGTAAGCA TTTATTTTCA GTATCAGTTG CACCGTATGG TGCACTTGTA GATAGAAGTT
ACTACAGCAT GGAGAAATTT GGAGATTAAC ATATAGACAT TAGACATTTT CTTTCATGTA ATATAGTAGT AGAACACACA
AGAGGTTCAA GCTTGAATGA TTAGAAAAGC TTCTTGCC

Locus: Os01g0675800

Loading...

Locus: Os01g0675800

Loading...