Os01t0678500-01

Locus

Os01g0678500

Description

Voltage-gated Ca2+ channel protein, Elicitor-induced defense reponses, Hypersensitive cell death, Activation of MAPK cascade

RAP-DB Gene Symbol Synonym(s)

TPC1, OsTPC1, Tpc1, OsCC1, OsCL1 pore

RAP-DB Gene Name Synonym(s)

TWO-PORE CHANNEL 1, Two pore calcium channel protein 1, Two-pore channel 1, Voltage-dependent calcium channel protein TPC1

CGSNL Gene Symbol

TPC1

CGSNL Gene Name

TWO-PORE CHANNEL 1

Oryzabase Gene Symbol Synonym(s)

OsTPC1, Tpc1, OsCC1, OsCL1 pore

Oryzabase Gene Name Synonym(s)

Two pore calcium channel protein 1, Two-pore channel 1, Voltage-dependent calcium channel protein TPC1

Transcript Evidence

AB100696 (Genbank)

AB071014 (Genbank)

AK067839 (Genbank)

Protein Evidence

Q5QM84 (UniProt)

B9EYL2 (UniProt)

Literature

PMID: 15111725

PMID: 15215504

PMID: 15941394

Note

Manual Curation

July 27, 2010

Gene Ontology (GO)

Biological Process: ion transport (GO:0006811)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: membrane (GO:0016020)

Molecular Function: ion channel activity (GO:0005216)

Molecular Function: calcium ion binding (GO:0005509)

Functional domain (InterPro)

Calcium-binding EF-hand (IPR002048)

Ion transport (IPR005821)

EF-hand-like domain (IPR011992)

EF-HAND 2 (IPR018249)

Full-length cDNA

J013126J24 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0678500-01)

Others

Oryzabase (3069)

KEGG (Os01t0678500-01)

Transcript

2789 bp

>Os01t0678500-01 Voltage-gated Ca2+ channel  protein, Elicitor-induced defense reponses, Hypersensitive cell death, Activation of MAPK cascade
AGTTAATCCCACTCCCACTTCCATATCGGCGTAACGCTCCTGTAAACTAATCCACTTCTA
CTTCCGCTTCCGCTCGCGGTTCCAGATCTCTCCCTGCACATCTGCATCCACTCACACTCG
AGGGAGAGGGAGAGGGGGAGAGATGAGGGAGAGGGGAGAGATGAGGGAGGCGAAGGCGCC
TCTGATCGCGGAGGCGGCGGAGCACATATCCCATTCCCACGGCTCCGGGTCGTCCGGCAC
CGGCAGCCACACCAGCGGCGGCGGCGGCGGGTGGAGGGGCTCGAGGCAGTACCAGCGCCG
CTCGGACGCCCTCGCCTACGGCAACCGGTACCAGAAGGCGGCCGCCCTCGTCGACCTCGC
AGAAGATGGTGTGGGTATCCCTGAGGATGTCTTGAATGACACAAGGTTTGAGAGGGCTAT
GAGATTCTATTTTGTGTATCTCCGGTTGGATTGGCTGTGGTCACTTAACCTATTTGCTTT
GATTCTTTTGAATTTTCTCGAGAAGCCTCTCTGGTGCCGGGGATATTCTCAACATGCTTG
TGATCAAAGGGATCTTTACTTTCTGGGGCAGTTGCCATACTTGAGCAAAACTGAATCTCT
CATATATGAGGGGCTCACACTTGTTATTCTTGTAATGGATATCTTCTATCCACTGTCCTA
TGAAGGTTTAAACCTATTCTGGAAGAACACAATAAATAAACTGAAGGTTCTTCTTCTCTT
CATCTTAGCATGTGACATACTGGTGTTTGCATTTAGTCCCCAACCTTTCAGAGTAGCTCC
TTACATCCGTGTTGCGTTTCTAATAATGAATATCAGGGAACTGCGAATGTGTGCTGTTAC
ACTGGTTGGTATGGTTGGGACATACCTTAATGTTTTGGCCCTTTCACTATTGTTCCTCTT
ATTCGCAAGCTGGCTAGCTTATGTAACATTTGAGGATACACCACAAGGAAAGACTGTTTT
CTCGTCATATGGTACCACGTTATATCAGATGTTTATTCTCTTCACCACCTCCAATAATCC
TGATGTATGGGTTCCTGCTTATAAGAGCTCTCGTTGGTCCTCACTATTTTTTATTGTCTA
CGTACTTTTGGGAGTTTACTTCCTAACAAATTTAATTCTTGCTGTCATTTATGATAGCTT
TAAGGAGCAGCTAGCAAAGCAAGTTTCTCAGGCAGACTGTACAAGGAAAAGTATACTAGA
GAAGGCATTTGGTATCATTGATGCTACTGGTCAGGGTTATCTCAACAAAGAACAGTGCCT
ATCATTACTAGATGAGCTCAACAAATACAGATCGTTACCTAAAACCTCAAGGGAAGATTT
TGAATTAATTTTTGCCGAGCTTGATCAGAGTGGTGATTTTAAGGTTACCTCTGAAGAATT
TGCTACACTGTGCAATACCATTGCAATAAAATTCCAGAAAGAACCACCTCCATCCTATCT
CGAGAAGTATCCATCTTTCTATCATTCAGCACTGTGTGAATGGTTGAAATCTTTTGTGCG
GAGCCCACTGTTTGAGTATATTGTTATTTTTGTTCTTCTGATGAATCTAGTCGCTGTCAT
TATTGAAACAACGCTGGATATAGAAAACAGCTCCTCGCAGAAAGTGTGGCAAGAAGTTGA
GTTTGTCTTTGGATGGATTTACGTTATAGAGATGGCACTCAAAATATTTTCATTAGGATT
TGGTGCCTACTGGATGGAAGGTCAAAACAAGTTTGATTTTGTGCTTACTTGGACTATATT
TATTGGAGAGACTCTAACATTTGCCTTCCCATCGAAGCTTTCTTTTCTTTCAAATGGAGA
ATGGATTCGGTACCTTCTTCTTGGAAGGATGTTACGCTTGACAAGAATTCTGTTGCAAGT
TCGGCGTTTCAGAGCATTTGTTGCAACATTCTTTACTCTGATGTCTAGCTTGATGCCATA
TTTGGGGATTGTATTCTGCACCCTTTGCATTTACTGCTCCCTTGGTTTGCAGATATTTGG
GGGCATTGTGTATGCAGGAAATCCAACACTAGAAGAAACCGATCTCTTCAGTAACGACTA
TCTTCTTTTTAACTTCAATGACTATCCAAGTGGTATGGTAACTCTGTTCAATTTGTTAGT
GATGGGCAATTGGCAAGCTTGGATGGAGAGCTACAGGCAATTGACTGGAAGTTATTGGAG
CCTGATTTATTTTGTCAGCTTTTACCTCATTTCAGTATTACTGCTGCTTAATCTGATTGT
AGCATTTGTGTTGGAGGCATTTTTTGCTGAGATGGAACTGGAGAAAGATGGCGAAGCTGA
TATCCAGGATCCTACTTTGGAAGGAAGAAACAGGCGGCGATCTGTGCGTGTGAGGACAAA
GGGGACCATGGTTGATATTCTTCTTCACCATATGTTGAGCAATGAACTTGATGGATCTCA
AAACCGTGACCAATAGCTTATCTTCATGGCCCTGCAGGAAGAAAGCAAGAACAGAAAAAA
AAAAGGAAATGATTAGAGCCGGTTCTCGAGCATGGAGTTATGTTTTGTTATGTCAGGTAC
TCAGGTGCAAAGGAATCTTGGTGAGGTGATGGAAAGGACTCTGCTTGTCATACTTTAGTT
GTCAAGGAGAACAGCAGATGTGTTCTCTTTCTGCTCCAAAGGAGACCTTAAAGGAGCTTT
TTTTTAAAAGTAAATATTGTAGGAGATTCTCCTACAGTGCATATATATTTATACAAAGGA
GCTCTTTTTGTATAGGATTAAAATGTGCTAATGGTTCTGGTGATTTTCTTTTTTGAAAAC
TTTACAGGTTATTATAGCCATAATACTCC

CDS

2274 bp

>Os01t0678500-01 Voltage-gated Ca2+ channel  protein, Elicitor-induced defense reponses, Hypersensitive cell death, Activation of MAPK cascade
ATGAGGGAGAGGGGAGAGATGAGGGAGGCGAAGGCGCCTCTGATCGCGGAGGCGGCGGAG
CACATATCCCATTCCCACGGCTCCGGGTCGTCCGGCACCGGCAGCCACACCAGCGGCGGC
GGCGGCGGGTGGAGGGGCTCGAGGCAGTACCAGCGCCGCTCGGACGCCCTCGCCTACGGC
AACCGGTACCAGAAGGCGGCCGCCCTCGTCGACCTCGCAGAAGATGGTGTGGGTATCCCT
GAGGATGTCTTGAATGACACAAGGTTTGAGAGGGCTATGAGATTCTATTTTGTGTATCTC
CGGTTGGATTGGCTGTGGTCACTTAACCTATTTGCTTTGATTCTTTTGAATTTTCTCGAG
AAGCCTCTCTGGTGCCGGGGATATTCTCAACATGCTTGTGATCAAAGGGATCTTTACTTT
CTGGGGCAGTTGCCATACTTGAGCAAAACTGAATCTCTCATATATGAGGGGCTCACACTT
GTTATTCTTGTAATGGATATCTTCTATCCACTGTCCTATGAAGGTTTAAACCTATTCTGG
AAGAACACAATAAATAAACTGAAGGTTCTTCTTCTCTTCATCTTAGCATGTGACATACTG
GTGTTTGCATTTAGTCCCCAACCTTTCAGAGTAGCTCCTTACATCCGTGTTGCGTTTCTA
ATAATGAATATCAGGGAACTGCGAATGTGTGCTGTTACACTGGTTGGTATGGTTGGGACA
TACCTTAATGTTTTGGCCCTTTCACTATTGTTCCTCTTATTCGCAAGCTGGCTAGCTTAT
GTAACATTTGAGGATACACCACAAGGAAAGACTGTTTTCTCGTCATATGGTACCACGTTA
TATCAGATGTTTATTCTCTTCACCACCTCCAATAATCCTGATGTATGGGTTCCTGCTTAT
AAGAGCTCTCGTTGGTCCTCACTATTTTTTATTGTCTACGTACTTTTGGGAGTTTACTTC
CTAACAAATTTAATTCTTGCTGTCATTTATGATAGCTTTAAGGAGCAGCTAGCAAAGCAA
GTTTCTCAGGCAGACTGTACAAGGAAAAGTATACTAGAGAAGGCATTTGGTATCATTGAT
GCTACTGGTCAGGGTTATCTCAACAAAGAACAGTGCCTATCATTACTAGATGAGCTCAAC
AAATACAGATCGTTACCTAAAACCTCAAGGGAAGATTTTGAATTAATTTTTGCCGAGCTT
GATCAGAGTGGTGATTTTAAGGTTACCTCTGAAGAATTTGCTACACTGTGCAATACCATT
GCAATAAAATTCCAGAAAGAACCACCTCCATCCTATCTCGAGAAGTATCCATCTTTCTAT
CATTCAGCACTGTGTGAATGGTTGAAATCTTTTGTGCGGAGCCCACTGTTTGAGTATATT
GTTATTTTTGTTCTTCTGATGAATCTAGTCGCTGTCATTATTGAAACAACGCTGGATATA
GAAAACAGCTCCTCGCAGAAAGTGTGGCAAGAAGTTGAGTTTGTCTTTGGATGGATTTAC
GTTATAGAGATGGCACTCAAAATATTTTCATTAGGATTTGGTGCCTACTGGATGGAAGGT
CAAAACAAGTTTGATTTTGTGCTTACTTGGACTATATTTATTGGAGAGACTCTAACATTT
GCCTTCCCATCGAAGCTTTCTTTTCTTTCAAATGGAGAATGGATTCGGTACCTTCTTCTT
GGAAGGATGTTACGCTTGACAAGAATTCTGTTGCAAGTTCGGCGTTTCAGAGCATTTGTT
GCAACATTCTTTACTCTGATGTCTAGCTTGATGCCATATTTGGGGATTGTATTCTGCACC
CTTTGCATTTACTGCTCCCTTGGTTTGCAGATATTTGGGGGCATTGTGTATGCAGGAAAT
CCAACACTAGAAGAAACCGATCTCTTCAGTAACGACTATCTTCTTTTTAACTTCAATGAC
TATCCAAGTGGTATGGTAACTCTGTTCAATTTGTTAGTGATGGGCAATTGGCAAGCTTGG
ATGGAGAGCTACAGGCAATTGACTGGAAGTTATTGGAGCCTGATTTATTTTGTCAGCTTT
TACCTCATTTCAGTATTACTGCTGCTTAATCTGATTGTAGCATTTGTGTTGGAGGCATTT
TTTGCTGAGATGGAACTGGAGAAAGATGGCGAAGCTGATATCCAGGATCCTACTTTGGAA
GGAAGAAACAGGCGGCGATCTGTGCGTGTGAGGACAAAGGGGACCATGGTTGATATTCTT
CTTCACCATATGTTGAGCAATGAACTTGATGGATCTCAAAACCGTGACCAATAG

Protein

758 aa

>Os01t0678500-01 Voltage-gated Ca2+ channel  protein, Elicitor-induced defense reponses, Hypersensitive cell death, Activation of MAPK cascade
MRERGEMREAKAPLIAEAAEHISHSHGSGSSGTGSHTSGGGGGWRGSRQYQRRSDALAYG
NRYQKAAALVDLAEDGVGIPEDVLNDTRFERAMRFYFVYLRLDWLWSLNLFALILLNFLE
KPLWCRGYSQHACDQRDLYFLGQLPYLSKTESLIYEGLTLVILVMDIFYPLSYEGLNLFW
KNTINKLKVLLLFILACDILVFAFSPQPFRVAPYIRVAFLIMNIRELRMCAVTLVGMVGT
YLNVLALSLLFLLFASWLAYVTFEDTPQGKTVFSSYGTTLYQMFILFTTSNNPDVWVPAY
KSSRWSSLFFIVYVLLGVYFLTNLILAVIYDSFKEQLAKQVSQADCTRKSILEKAFGIID
ATGQGYLNKEQCLSLLDELNKYRSLPKTSREDFELIFAELDQSGDFKVTSEEFATLCNTI
AIKFQKEPPPSYLEKYPSFYHSALCEWLKSFVRSPLFEYIVIFVLLMNLVAVIIETTLDI
ENSSSQKVWQEVEFVFGWIYVIEMALKIFSLGFGAYWMEGQNKFDFVLTWTIFIGETLTF
AFPSKLSFLSNGEWIRYLLLGRMLRLTRILLQVRRFRAFVATFFTLMSSLMPYLGIVFCT
LCIYCSLGLQIFGGIVYAGNPTLEETDLFSNDYLLFNFNDYPSGMVTLFNLLVMGNWQAW
MESYRQLTGSYWSLIYFVSFYLISVLLLLNLIVAFVLEAFFAEMELEKDGEADIQDPTLE
GRNRRRSVRVRTKGTMVDILLHHMLSNELDGSQNRDQ*

5'UTR

chr01:27920808..27920949 (- strand) : 142 bp

CDS

chr01:27920592..27920807 (- strand) : 216 bp

chr01:27919310..27919453 (- strand) : 144 bp

chr01:27919096..27919203 (- strand) : 108 bp

chr01:27918575..27918670 (- strand) : 96 bp

chr01:27917946..27918055 (- strand) : 110 bp

chr01:27916703..27916763 (- strand) : 61 bp

chr01:27916059..27916225 (- strand) : 167 bp

chr01:27915866..27915971 (- strand) : 106 bp

chr01:27915665..27915742 (- strand) : 78 bp

chr01:27915181..27915242 (- strand) : 62 bp

chr01:27913969..27914041 (- strand) : 73 bp

chr01:27913049..27913114 (- strand) : 66 bp

chr01:27912555..27912698 (- strand) : 144 bp

chr01:27911866..27911923 (- strand) : 58 bp

chr01:27911096..27911203 (- strand) : 108 bp

chr01:27910448..27910511 (- strand) : 64 bp

chr01:27909876..27910044 (- strand) : 169 bp

chr01:27909457..27909521 (- strand) : 65 bp

chr01:27909226..27909316 (- strand) : 91 bp

chr01:27908686..27908772 (- strand) : 87 bp

chr01:27908415..27908486 (- strand) : 72 bp

chr01:27907813..27907853 (- strand) : 41 bp

chr01:27907647..27907734 (- strand) : 88 bp

3'UTR

chr01:27907635..27907646 (- strand) : 12 bp

chr01:27906702..27907062 (- strand) : 361 bp

FASTA

>Os01t0678500-01 class=Sequence position=chr01:27906702..27920949 (- strand)
AGTTAATCCC ACTCCCACTT CCATATCGGC GTAACGCTCC TGTAAACTAA TCCACTTCTA CTTCCGCTTC CGCTCGCGGT
TCCAGATCTC TCCCTGCACA TCTGCATCCA CTCACACTCG AGGGAGAGGG AGAGGGGGAG AGATGAGGGA GAGGGGAGAG
ATGAGGGAGG CGAAGGCGCC TCTGATCGCG GAGGCGGCGG AGCACATATC CCATTCCCAC GGCTCCGGGT CGTCCGGCAC
CGGCAGCCAC ACCAGCGGCG GCGGCGGCGG GTGGAGGGGC TCGAGGCAGT ACCAGCGCCG CTCGGACGCC CTCGCCTACG
GCAACCGGTA CCAGAAGGCG GCCGCCCTCG TCGACCTCGT CGGTTCCCTC CTCCTCTGCC TCCCTCTTGT GTCGTTCGTA
CTCGTTGTTA GGCGAAGCGC GACGCTGCTT TGCTGTAGGC TGCTCCTGTG TTGGGAATTG CGGTGATCGT GGTCGTGGGT
TTGTCGGGGT GGGTGGTGTG CGCTGGCGAG CGTGGATGTA GGGGCGGTGT TTGATGGATT GTCTGCCCGA GCTCGGCATG
TTTACGTGGT GCGGGAGCTT GGCGTGGTCG AGGTAGTTGT TTGCAGCTTG TGCTCTGTTC GGAGCCGTGA GATAGGGCCA
AGGCGCCACT CGGCATAGGT TGCTTGGCGA TAACCTGAAC TTTGCGCACA TTTACGTGCC AATGCCAGAA TTAAGCGTGG
TTTCAGTTGT GCTGTTTTAT GACAGAAAAC GTACTAACAG TGTTTAAGTT GACTTTCACT ATTTCCGATG TTGCATATAG
CTGTTAACTT TTGTTTCGAT TTTTGCAAGC GCTATCTTTG AATTATGTTA AAAATGTACC ATCTAAAAAT TTTATCATGT
GCAAATTGAC GTTTTACTAT AACTGTCGTG TCATTTGCAT GTGAATTCTC ACTCAATACC CAGTACCATA ACAAGAATAT
ATGTTATCCG TCGACACTCT TAGCTAACGG ACTTAGCGCA GTAAATCCCA TTTTCTTTTG CAACACAACT AGGGTATCTT
TAATGATGCA AAACAAGGTC TACATTTGTG TTTTGCGATC AGGGTTCACT CTATCGGTTC AGGGTTTTCT ATCGGGGGTC
ACCGAAATCC TGAAATTTCG GTCCAAAATT TCCGAAATTT TAAacaaaat ttagttgaat ttgaacaaat attatccaaa
ttcatgaaaa aattgaaaaa ttcaaaaatt tcggccgaat taatatcgta tcgggggtca cttggaaatt tcggtccgaa
atttccaacc ctgttTGCGA TATTGTTGTC ATTTTCTGAT GAGTTCACGT CCTCTACCAT AATATCACTA CCATTACAGG
CACTGACGTG TGGGACAATA GGAGGATAGG ACCCACATAC TAGTGATTGT AATGGTACTG TAATGGTAGT GACTTTATGG
TAGAGGATCC TCACCCTTTT CTGATATACT GGGAATTAAT TGCAATGGTT TGACAGGCAG AAGATGGTGT GGGTATCCCT
GAGGATGTCT TGAATGACAC AAGGTTTGAG AGGGCTATGA GATTCTATTT TGTGTATCTC CGGTTGGATT GGCTGTGGTC
ACTTAACCTA TTTGCTTTGA TTCTTTTGAA TTTTCTCGAG GTTAGTTATG AAAATGGAAC CCATCTATTA CATTGTACAG
GAAAGCGGCT AAAATCCTGC AAGTCCCATT ATGGTCATGT TTTGAGTTGT TTCTTTTGCA TTTCAGAAGC CTCTCTGGTG
CCGGGGATAT TCTCAACATG CTTGTGATCA AAGGGATCTT TACTTTCTGG GGCAGTTGCC ATACTTGAGC AAAACTGAAT
CTCTCATATA TGAGGTAAGG CTTTGTCTAT AAGAGTGGTG TTTCTATGTT CTCTGAAAAC TTTAATTGCA GAAAACTTCA
AAAACTACAG TCGGTAGTAG ATTAATGAGC AGTTGGAAAG TCAGGTCAAT AATTTGCTTT TGTAATTACA CTCAACTTTG
TTGGTGACCA TTAAAGCAAC CTTTGGTGAC TATACTAATC ACAGCTTCTC AATATTATTG TTGAGCTTTG AGATGTATTG
CATAGTTAGT TGGGCCAGAG CATGGTCATT TGAGTACATT AAAATCTGAA TTCCATCATT CTAGATTTTG TATGGTTATT
TGTTGTATAA CAGGATAATG CACATGCTTT TTTTAACGAA CATGTAATGG TCTGTATTGA GGACTGAAAA CATTAATCTG
ATATATTTGA CGCAAACTTG CCGTTCTTTT CAATTTCAGG GGCTCACACT TGTTATTCTT GTAATGGATA TCTTCTATCC
ACTGTCCTAT GAAGGTTTAA ACCTATTCTG GAAGAACACA ATAAATAAAC TGAAGGTATG GCATCTGTTT ATAAAATAGA
TATATATGAG TATAAATAGC AAGAATAGCA TACATGTTTG TTTTTCTAAG ATCCATTGAT GTGGATAGCA TACAAGTATA
AACTGAAGTT AAATAAAACT ATGTAACTGC AAAAAATAAT GGATGATGTG GATTACATCT GGCCCTACTG AGATAAAATC
TAAAATTTGA AGGCATATGT GAGTGAACAT TCACATATTT AACTACTTTT TGTAAATTAA CTATGTGCTT TTACGTATGA
GGGATGGCTA TTTTTTTTGT TAGATTTGAC TAGGCCCTTC CAATTTTTGA TACAGTTACA TTCAAGCTAA ATAAACTTCC
TTGTTTTAAC TAGACTACCC ATTGTGCTAA CTCTGCCCCT TTTAATTCCT ACGCTGCAAA CAGACTGTAA TCCTGTTGTT
TTACTTTAAT TAAGCATATG TTTCTCTCTA AAAATGTGTC TTTCTTACTG CTTCACAAAC TGTGGTCTAT CCATATTTCT
GCTTTGTCTT GTAGGTTCTT CTTCTCTTCA TCTTAGCATG TGACATACTG GTGTTTGCAT TTAGTCCCCA ACCTTTCAGA
GTAGCTCCTT ACATCCGTGT TGCGTTTCTA ATAATGAATA TCAGGTTTGC AGTGTTTTAT CTACTCTAGA CTACAGTTTC
TGCTGCTAGC TTTCTGAATT CAGTATGAAG GTTCGTTACT GAATCAATCT CAAAGAAAAC TAGCTGGGTG GCCCGCGCAA
TTGCGCGGCT AGCACCCATA CAAAATTATC TATTTTTTAC ATATTATTTT ACTTAAATTT TGTTAAATAG CTAACTCATT
GTCTTAGGAC TTTGAAAGAC CGAACTTTAT CATCCAAGTG TTTCTAATtt tatatttttt agaagtcacg ctagtcgcta
cccctttatt tgttgccgat ttaccaccgt ttctattcat cctcctcatt tgtcatcgtt gtgttctaga tggacttttt
tttttgaaaa ttccatattt ttcaccctga tattttttta tttataaatt gttttcctac ttgaactctt ataattattt
ttctatgttt ggaatttatt ttatttgtta cttcggattt taattaatct cgtcatgtgt tcttgatggt ctcttctttc
aattgtcttt attttttatt aagaatttta attatttata attgtattcc tagttgaact cttattttcc tttttataat
ttctgaattt attttatttt ttatttagat tttaattaat cttgttttgt gttctatatg gactattctt tcgatgttac
ttttttttta ttttaaattt tAGTTGtttc aaaattgtat taatatttga actctatttt atttttctaa taatttctta
atttatttta ttttttattc caaattttaa ttaatcgtgt attgggttct tatatggact ctttttctaa tattgcttat
ttttaattcc aaatttcagt tattttaaaa ttgtattcct acttggactc ttctttcttt ttctccgatt aatgtggtaa
tttctagcct ccacaacgaa cgtggtgcct cctttcaatg ctatcttaat aatataatag ATAGATAGAT GACCTAGATT
TCTGCAGGAT AATCATACTG CATAGCAAAG AGAAGACCCA TAAATAATTA TAATTAGCGT TCACATAGAC ACATAGGCAA
ACACTTACCT GTCCCATTTA GGAAAAGATA CATGTCAATG TTAGTTAAGA TATATGTTAT TTTTTTGATT GTTTGACAGA
TGTATTAACT GTTCCTTTTG TGACAGGGAA CTGCGAATGT GTGCTGTTAC ACTGGTTGGT ATGGTTGGGA CATACCTTAA
TGTTTTGGTA AGACTTTATT AATTATGCAA AATTACTATA CTTCTAGCAC TGTAGGACAT ACAATGATTA TATTCCTTCA
GAATAAGCCA TTAGAAGTTT TTGTCTATGC TTGAGAGTCA CGGGGACCTT TCGTTACTCT CTTCATCTGA TGGTTTGTGG
TGCATGAATT GAAATTGTGG ACACCAACTT ATAAATAGTG TGGGACCATT GTAGATTTAG GTAGGCTGGG AAGGAGGGGG
AGATTGTTCT CTTCTGACAT CCTGTTCATT CTTGAGTTCT GCCCTTTCTG CTTTCCAATA TAAAAGTCAA TTTTGAACTA
CATTTTACGG CCTAGTTATT GGAATACTAA TTACAAAGAT GTTTACCTCA ATTTACTTTT CCATGAGTTT CTTATGGTTC
TGCATGTTCA TATTTATGTC TGCATTAGTG CACATTATGT GTTCAGTTTT GATGCATATC TTTTTGGTCG CTTGCATTAT
GTAGGCCCTT TCACTATTGT TCCTCTTATT CGCAAGCTGG CTAGCTTATG TAACATTTGA GGATACACCA CAAGGAAAGA
CTGTTTTCTC GTCATATGGT ACCACGTTAT ATCAGATGTT TATTCTCTTC ACCACCTCCA ATAATCCTGA TGTATGGGTT
CCTGCTTATA AGTAAGAAGG CATCACTATT ACTGAAGTGT TTATGATAGT TCCTGCATAT GACATGCATA CAAATTAACC
TTATACATCT TTGAGCAGGA GCTCTCGTTG GTCCTCACTA TTTTTTATTG TCTACGTACT TTTGGGAGTT TACTTCCTAA
CAAATTTAAT TCTTGCTGTC ATTTATGATA GCTTTAAGGA GCAGGTGGGT TCCTCACCTC TGTCCTAATT CACATGATGA
TCGCTATTTT TTTTTGTTAT GAATTCTGAG TTATTATTAT TATTATGCTT CACATACTGC TAACATGGCA TATTTTTTGT
GATCTAGCTA GCAAAGCAAG TTTCTCAGGC AGACTGTACA AGGAAAAGTA TACTAGAGAA GGCATTTGGT ATCATTGATG
CTACTGTAAG TGTTTTCCAT TTTATGTTGT CCTGCAAACT AGTGCACCAC AATTTGGCAA CGTATTTTAG TGCAAGTATT
TTTTATGTTT TCCTGAAAAC TGATGCACCT CAGCAGTACT TCAGTACTTT AGTATAACTT TGATGTTCAG GTTATCCTTC
ATCAGAGTAT AGTCTGATCA CTTCGGTTCT CAGTTGGGAT TATTTTAAAT GTTCAAATTA TCAAATAAGC AGCACTAGCT
CACCTTCGCA AGGCGTGATG AGATTAATAT TATAGATCTT AGATTAGGGA AAACGAGTTA GCAAGAAAAT CAAGGTCCTG
CTGCTATTGA GATGATATAG ACGTGTTTAG TTGTTTGGCT GTGTTATTCA TGAGTATTAT TAATATTGGC TGCTGATATC
CCTTTCTTCC CTATCTGTGG ACATCAGGGT CAGGGTTATC TCAACAAAGA ACAGTGCCTA TCATTACTAG ATGAGCTCAA
CAAATACAGG TAACCAAAAT GCCCTCTTAC ATTACACTCC TTCAAATCTC CTTATTACAT TATAGAGTGA TTTAGTCCTT
GAGGGGGTAC CATACCTTTT AGTATTAAAT TTGTGCtacc ttcaggtacc tcaacttaaa tttgtgctac cttcaagtac
ctcaacacaa gggaggtacc aaaaatttac actgaaaata cagtacctcc cggtacatcc tcaaggaatg taaaCACTGC
ATTTTATGGG TAGTAAGTTT ATTTTTACAA TCTTTTTTGT GGAGATGTTC CTCCATTTCC TGAAGGAATC TTAAGTCAGT
CAAAATCAAT ATCTGTCATG CATGAAACCA ATCTTCAAAA TTAAATCCAT AGTAGGTAAA GTGGTTAGCA AACGTGCTGA
AGGAGATCCC ACCCAACCCA GATGCCAACA AAATTAACTC CATGTCCATG CCAAGGGTAT AAGAAGTCTC TAATTGCCCC
ACTTCCGTGC AAGCTTGATG CTATCTGTGA AAGTGGCCGA TCCATTAAGG AAGGTCTTTT TTTTTTTATC CTTACACTGA
AAACTGAAAA GGGTAACTAA CTCATGCAAA TGGTAAGCAA AAGAAAAACC CTTTAAACAA TGACGTGACT GCCTTTGGAA
GATGGGCATC CTTACTGGTC TGTAGAGCCA AATATCCATT TTTATGATGA TGCACTGGTA CTTGAATACT CATTAGATGA
CATGCCATCT CGAAGAGAAC ACAGGTCAGA ATGGGTGTCT GCTTTCGTTA TTACAATCTC AATGCTATTC CAAATTACAT
TATTTCAGTT TTGCTCCATT ATTTTGACAT TCATAACATA TATCAGAAAT CAGCAGAATT AATTGTGTAG AAAATGTCAA
ATTAATATCT AGAAGCCTAG AACATGGTTC TTACAATTGC AGCATATCAT GCTGTCCACT TTTCGGTTTT GCATTTATTG
ATTTTATTGA ACCAACAACT TAATGGTTTG TAAGTGTAAG TTAGTTTTGC TTATTATCAT AACATGGTAG GGAGACATCC
CTTCCCCTCC AAAGTTGATG ACGACAGATG TTATCCTTGC ATTTTACCAA ATTCCTGCTA GCTCCTGGAT CAGTTATGGG
TCTCACAGAA TGGTGCCTCC TTTTGTAGAT CGTTACCTAA AACCTCAAGG GAAGATTTTG AATTAATTTT TGCCGAGCTT
GATCAGAGTG GTGATTTTAA GGTACGTGCT CCTACTATCT TCAGTAGGCA TGTCTTAGTT TTAATAATTC TTCAAGCACG
TTCACCCTCC ATCCTCTCCC CCTAAGCCCC CCCCCCCCCC CCCCCAAAAA AAAAAGTACT TGTAAGAATG TTTATAACAA
AAACACTTAA GGCTGTGTTT AGTGGTGGTT GGAAACCTTT TCCCTCCGCa cggaaaatga ggtagcacat tagcacatga
ttaattaaga attagctaaa aacttaaaaa tggattaata tgatttttaa gcaacttttc tatagacttt ttttttggtg
caaaaaagca ccattcagta gttcgggaag catgctcatg ggaaacgagG GAGTAGAGGT TGGGAAACTT GAGTTCTGAA
CGCAGCCTAA GAAGCTGGTA CTAAggccat ccccaaccca gaaactatca aatagtttcc gtacttgcta tgtcatatag
acactatgta tagaaactac aattcaatgg atggtgtctt caaattaaat tctcatccaa tcacctctct tctctctcct
tttatctacc tatccccttg ttttcattct tggttcttgt gtagagatgg tttcttgcat gagaaatggt ttattcatct
ttttacctct ctcctcttta gctctcttgc cacatcagat ttttgcttat gtggcaatgc attaaatgct atggagacta
gatggcatgg ttggggatgg ccTAATTATC ACCTGTACCA TTTTCTGAAA GTATACATGC CTCAGTGAGG TCTTAATTCT
GATGTTAATT TTTATCCTCA TTTGATGGTA TGGCATGTTA GTGTTTTTTT ATCTCACTTA TTTATCCTTG TCCAGGTTAC
CTCTGAAGAA TTTGCTACAC TGTGCAATAC CATTGCAATA AAATTCCAGA AAGAACCACC TGTAAGTTGT ACTTATTTTG
ATGTTCATAA TTTTCTACTC TTTCTTTATC ATGGAAAATT GAAAGCTATA CTCCTTCAAC CTAAAACAAA TACCCTCTAT
TTGACTTGCC ACAAACCCCA ATGCAAAATC TTGGCTGTTA TTTTATTGTT ACTTTTAGCA AAAGTTTAAG GAAATGTTTT
GTGACATTAT GTTTTTGCCC TTCCCTTGTT TACACAATCT GAATACTTCA ATTGCAAATG TATCAATGAC CAAATATTGT
TAAGAGTGTC AAGGATATAA ATACGTCGAT GTTGCACTGT TTGCAGCAAC ATTCTACCTT GTTTGACCTA ATGTTGTACA
TATTTTTGCA GCCATCCTAT CTCGAGAAGT ATCCATCTTT CTATCATTCA GCACTGTGTG AATGGTTGAA ATCTTTTGTG
CGGAGCCCAC TGTTTGAGTA TATTGTTATT TTTGTTCTTC TGATGAATCT AGTCGCTGTC ATTATTGAAA CAACGGTATG
GCAGTTTTTT TTTCTTCTAA TTTGTGTTTT ATTTTTATTC AACTTGGAAT CATACTTTAT ATTGTTAGCA GTATTCTATT
TCCATATCTG CTAGACTTAA ATTTATACTC TTAGCACTTC TCAGTATTTG TTTTCTATTT TTTGTTTACT ATCAACTACT
GAGTACATGG CAGCGTAATC AGCCTACTAT ATTAGCTTTG CAATAGTTTG TTGACTACAA AATTATTCAA TCTAAGTTAT
CTATGCTAAT ATAAAAGATG GTAATGGTGA GTCTACCACC ACCAACACCT GACCACCCAA CTACCATGCG GGACCTACGA
ACAGTGAGAC AAAACTTTGC TTGTTTCCCA GCCCCCACAT GCTATAGACC CCAGCGCAAG GAAAATATGA CAATAGAATA
TTATGGATTT TTTCATCTTT GTGAAATGAC AACAAAATTA GCACAATGAT AATATATTAG ACAATTAGAA ACAAATTTTG
TTGCAACATA CGGGCATTAT GCTAGTGTTT AACAACGTTT TGTAGACAAG GAAGCATGGC TTCATTTTAG AACCAAGAAT
TGAAATAATT AAATTCACAA ACGGATGTGA AAACTGTATG TAATCCCTGG GATATGATTT TTGCAGCTGG ATATAGAAAA
CAGCTCCTCG CAGAAAGTGT GGCAAGAAGT TGAGTTTGTC TTTGGTAAGC ATATTTTGGT GAACTTTGTT TCAACAATGC
TCTGTAAGCA GTAACTATCT CCTATAAAAT CTCCCTGGCA TATTATCTTG AGTTTCCAAC TTAAAGTTGA CACTTGAAGA
ATAATTGCCA TTTCTCTTAG GTTTGATGAT TATGTAGCCG AACTTCAGAA TTTGTATTCT ACTGTAGTAG TCTGTCGTTC
TTAAATTTTG TTGAAAGGGT CTACTGTGTT TTCCTGATTT AGGTTGCTGC AGTACTGTGG GGTCGATACA GAATCGCATA
TGATTGCAAT GGTCATAAGT TTATTCCCTC TATTTAGAAA TGTATATTGT ATCAGAAATC ATGTAATCAA ACTTCTTACA
CTGTTTTCAC ATCCGTTTGT GAATTTAATt atttcaattc ttggctgtgt acatctgttt ggatgtagag gccggtttaa
tccatcatct taaaaaaaAG TTCTTACACT GAGGTTTGAC ACAATTAAAT TCGTAGTTTA TTGAACTTCA CGAGTATATT
CATAAGAAAG TACCCATTCT GTCCTTTTTT TATAAGGTGC ATATGGTGCA CGATGTTATG GAGTGCTGGC ATTGTAATGT
AATAATATGT TCATATCCTT GTCTTCACGT ATGTAAGTAT GTCAATACAA ATCTATAATG TTGCAGGATG GATTTACGTT
ATAGAGATGG CACTCAAAAT ATTTTCATTA GGATTTGGTG CCTACTGGAT GGAAGGTCAA AACAAGTTTG ATTTTGTGCT
TACTTGGACT ATATGTAAGT TAATCCTACT AATTTATTTT GAGACGATTT TAGTAACAGT TCTGTGTAGT TGCTTATTTT
CTTCCATTGC TACTTTTCAC CTTGCATTTT AAAGAAAAAT CCATATTACC AAGAAGTATT TCTGGTTCAA AAGAAGAGTT
GCATTTCACA ACAAAACTGA ATTAGAAAAA TATTGTATGG GTGAGAGGTT ATATTTTAAG AATACTATAT TTAAGAATAG
GTGTGTGCAT TCACTGTTAC TGAAAAACTA TGGAGTATAA TTGATTTTCC CTTGGTCATG ATTGGATGAT GATAAACTCT
CAACTTCAAA ACCATGTTTC CTTTCCAAGA AAATAACACT GGTCATATCA AATGCGTTAT GTTCTTCAAA TTTAGCTTTT
GCCTAACCTG GACAACCAAA TATTCTTGTT CCATGCAGTT TCCGCTGAAA ATAAGTAAAT AACTAGTACT GTATATTCAA
CTGCCTTAAT TCATATCTGA AAAGGAGTAT CGTTGGAAGA GAACTTTTTT TTTTTTTTTG CATATAGTAA TCTTCTTGCC
AATTACTTTG TGGCATCTGA CTTCTCATTT CATTGTAGTT ATTGGAGAGA CTCTAACATT TGCCTTCCCA TCGAAGCTTT
CTTTTCTTTC AAATGGAGAA TGGTAATTTC ACTGTTTTGG ATGCTTTACT TTCCAAAATT TAGTCAATCC ATCATATGTA
CATCAAGATA CAAACATCAA TCCTTTTAGT ATGCATCATG CTCTTTAATT GCTGAAACTA AATtaataac ctctttccta
atatgatggt gatttaagaa ctatgtactt aagttACCAT GTGAATAAAA AATAAACTCT AACCTGAAAT ATCATGTTGA
GCTATATGGG TTGTTGAATC TTAATAATTG CCCTGAACTT TACTTTGAAT CATCACTTTA ACATTAAGTC ACTTAAACAG
GTTCTGAGTG GATAACAGTT CTGACAGAAT TCTCTGTTAA CTATTTATCG TTGTTTACTG CCTTGCTCTA ATAATCCTGA
TTTTCCTCTG AATTTTGCCT GGCAGGATTC GGTACCTTCT TCTTGGAAGG ATGTTACGCT TGACAAGAAT TCTGTTGCAA
GTTCGGCGTT TCAGAGCATT TGTTGCAACA TTCTTTACTC TGATGTCTAG CTTGATGCCA TATTTGGGGA TTGTATTCTG
CACCCTTTGC ATTTACTGCT CCCTTGGTTT GCAGGTTGGA ATAAACTAAT GGTTTTCCAT ATCAAGTTTA ATGTCCTAAA
TAGTTCATCC AAGAGCTTAA AGTTTTTGGG GAAACATAAA TATTTGTGCT CATTCTTCAG TGCTTCCCCT CACATGCAGT
CTTGACAAAA TTGCTGGTCC AGTTTGTTTA CTGGTCACAG CAATCTGTTA CTTACACTAG TGATTGGAGT TCCTTTTCTT
TGTTCTTAGA TTGTCCAGTT ACTAATTACT ATTGTTATTT GTACTTTTCC TTGTCTAAAC AGCACGTCAT TGCTGTCTAT
ATATCATAAA CACTTTTCAC ACCTCAATTA TTGTCATTAG ATGACAGTCT CGAGTCTTCT GTTTGCAGAT ATTTGGGGGC
ATTGTGTATG CAGGAAATCC AACACTAGAA GAAACCGATC TCTTCAGTAA CGAGTACCCT TTTTGTTCTT ATTTCACCGT
TTTGATTTCT AAAAAGTTTT AGAAGTGTTT TTGTTCCAGT AACTTCTATA CTAAAATCTC ACCTTCTATT TATTTTTGAC
AAAATTCTCA CTCTTTTACC TTGGCATGTG CAGCTATCTT CTTTTTAACT TCAATGACTA TCCAAGTGGT ATGGTAACTC
TGTTCAATTT GTTAGTGATG GGCAATTGGC AAGCTTGGAT GGAGGTAAGA ACATGGCAGC CATGCATGTG CTCAATCTTG
CTTGTTCTAT ACACTGAATA TTTTATATTT TGAGGGGTGA GAGGGTGGTT TTGTATGCAC TGATTTACTT TACTATTTTT
CACCTTGATA AGTTGACTCA TGTAGAGCCT GCCCATTTTA CTGTATCCAA ATGAATGCTT AAGATCTGTG AAATTAAGTT
TAAAAGTTTA CCCTATAGAT GTTAAAAAGT ATGCAACTAG AAAAAAGATA GTTAAGAGTA ATAAATCAGA AGGAAAAGGA
TAATATTTTC TCTCTTATAT TTATATTCTT ATAAATTTAG CTCATTGATC TGGATCATCT GCCTACAATA ATTTAAGTAA
AATCTGCCAA AATGTCTTGA GTGACTTATT TTATTTGCTA ACCTTCGTTT CCTTATCTTT GTTCTTTTGA ATGAAGCTCC
TTTTTTCTTT CTTTCAGAGC TACAGGCAAT TGACTGGAAG TTATTGGAGC CTGATTTATT TTGTCAGCTT TTACCTCATT
TCAGTATTAC TGCTGCTTAA TCTGGTAAGA TATTAAATAG TTATTTCAGT TTTTGTTCAT GCAGTGACAT TCATGGCATT
TCTAATATTG CATGATACTG TTGTTTTTAT TATTTATGTG CATGCAGTTA GAAAGTTGTT GACATTCCTA TTATCCTACT
TATATTTTTT AGATGATTAT TTGTTGATTA AATAAATTGT GTCCTCCCTT TTTTTTCCCT CAGATTGTAG CATTTGTGTT
GGAGGCATTT TTTGCTGAGA TGGAACTGGA GAAAGATGGC GAAGCTGATA TCCAGGTTAG AACAATATTT GTGCCGACAA
CAAATTCTCT TTACTTGTAT TTAGAAAACT GCTGAAAAGC CAGTAATTAA CTGGTTACAG GTAGCCTAGT TGTCCTTTGA
CAACATCGAT TCACACTACA CTATTATCGC ACAATTATTT GAATAAGTAC GAATCGAAAC CTTGCCAGTG TTGCCTTAGG
TGAGTTTGAG CAGCTGAGGG ATGGTTGAGG CTAACGTTTG GTTTGTAGTT GCACTTTCTG AGCCAGCTTG CCAGTTGCCA
TTTGGTTGTG CGCTCATGTC ATGTGTCATC TCCAAATTGT GGCTAAGTGT GGGAACCAAT CAAACGACTC ATGAATCCCA
CTTCTCTTGA GCTTTTGATT GGAAGTAGTA CTATATCTGT TTGGTTGTTT CTAACTTTCT GTTATGTCAA ATCAAGAAAG
AATTTGGCGT TACTAGCTTC GCCTACACAA ACTGTGGATT ATAAAGTATA AAATAACTTT AGTTTGTATA AACTTAAGCA
GTTACCTGGA TTGAAATAGC TAGTAGTTTT TTGAGGGCAT CTGTTCATCC ATGCAGGATC CTACTTTGGA AGGAAGAAAC
AGGCGGCGAT CTGTGCGGTA ATAAAAGAAA ACGATTAGTT GTTATGGCAT GATAACATAT TTCTGCAACA TTAATTTACC
ATTGATGTTG TGCAGTGTGA GGACAAAGGG GACCATGGTT GATATTCTTC TTCACCATAT GTTGAGCAAT GAACTTGATG
GATCTCAAAA CCGTGACCAA TAGCTTATCT TCATGGTACT ACCCTGTTTT TCTCTCCAAT GGCAACTCCC GTAAAATTAG
ATGACCGAAT ACATGATTTG AAAATGCTAC CAGCCATTTC TAATATTTCT GATGCCTATA CCATGTCACT GTGTGCTAAT
GTATTTTTAG TTTTTTACTC TAGCATAGGT AATCGGTATT ACTGTATTAG ATCAGCCGAT CAGCCACATC ATTTGCATTC
TTGCGTTCTA TGCCTTCCAT TTAAATCAAG GGTgtagcta tatttatggt gccatatttt tcatcaaaaa atagtcggca
tgtatttaca ttgtaagtcc ctaaattaca tatgtaattt tagtgtattt acaatgtaag tctcaaaatt acatatgtaa
gtactaaaat tacatatgta aattcaaaaa ttacatacta attacatatg taagtGGGGT GTAAATGAGG TGTAACTACT
GTGTAAGTGG CTGAAAAAAA TCGACTATAG CATATGGCGC CATATTTCTA GCAACTCCGT AAATCAATTG CTTCTTTTAC
CATGATTAAT ATTTTTAACT CAGGTCTTTT TTTTTTTTAA AAAAAAGGCC CTGCAGGAAG AAAGCAAGAA CAGAAAAAAA
AAAGGAAATG ATTAGAGCCG GTTCTCGAGC ATGGAGTTAT GTTTTGTTAT GTCAGGTACT CAGGTGCAAA GGAATCTTGG
TGAGGTGATG GAAAGGACTC TGCTTGTCAT ACTTTAGTTG TCAAGGAGAA CAGCAGATGT GTTCTCTTTC TGCTCCAAAG
GAGACCTTAA AGGAGCTTTT TTTTAAAAGT AAATATTGTA GGAGATTCTC CTACAGTGCA TATATATTTA TACAAAGGAG
CTCTTTTTGT ATAGGATTAA AATGTGCTAA TGGTTCTGGT GATTTTCTTT TTTGAAAACT TTACAGGTTA TTATAGCCAT
AATACTCC