Os01t0678500-02

Locus

Os01g0678500

Description

Voltage-gated Ca2+ channel protein, Elicitor-induced defense reponses, Hypersensitive cell death, Activation of MAPK cascade

RAP-DB Gene Symbol Synonym(s)

TPC1, OsTPC1, Tpc1, OsCC1

RAP-DB Gene Name Synonym(s)

TWO-PORE CHANNEL 1, Oryza sativa two-pore channel 1, Two-pore channel 1, Two pore calcium channel protein 1, Voltage-dependent calcium channel protein TPC1

CGSNL Gene Symbol

TPC1

CGSNL Gene Name

TWO-PORE CHANNEL 1

Oryzabase Gene Symbol Synonym(s)

OsTPC1, Tpc1, OsCC1, OsCL1 pore

Oryzabase Gene Name Synonym(s)

Two pore calcium channel protein 1, Two-pore channel 1, Voltage-dependent calcium channel protein TPC1

Transcript Evidence

AK100998 (Genbank)

Protein Evidence

Q5QM84 (UniProt)

B9EYL2 (UniProt)

Literature

PMID: 15111725

PMID: 15215504

PMID: 15941394

Note

Manual Curation

July 27, 2010

Gene Ontology (GO)

Biological Process: ion transport (GO:0006811)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: membrane (GO:0016020)

Molecular Function: ion channel activity (GO:0005216)

Molecular Function: calcium ion binding (GO:0005509)

Functional domain (InterPro)

Calcium-binding EF-hand (IPR002048)

Ion transport (IPR005821)

EF-hand-like domain (IPR011992)

EF-HAND 2 (IPR018249)

Full-length cDNA

J023146P13 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0678500-02)

Others

Oryzabase (3069)

KEGG (Os01t0678500-02)

Transcript

2801 bp

>Os01t0678500-02 Voltage-gated Ca2+ channel  protein, Elicitor-induced defense reponses, Hypersensitive cell death, Activation of MAPK cascade
CTTCTACTTCCGCTTCCGCTCGCGGTTCCAGATCTCTCCCTGCACATCTGCATCCACTCA
CACTCGAGGGAGAGGGAGAGGGGGAGAGATGAGGGAGAGGGGAGAGATGAGGGAGGCGAA
GGCGCCTCTGATCGCGGAGGCGGCGGAGCACATATCCCATTCCCACGGCTCCGGGTCGTC
CGGCACCGGCAGCCACACCAGCGGCGGCGGCGGCGGGTGGAGGGGCTCGAGGCAGTACCA
GCGCCGCTCGGACGCCCTCGCCTACGGCAACCGGTACCAGAAGGCGGCCGCCCTCGTCGA
CCTCGCAGAAGATGGTGTGGGTATCCCTGAGGATGTCTTGAATGACACAAGGTTTGAGAG
GGCTATGAGATTCTATTTTGTGTATCTCCGGTTGGATTGGCTGTGGTCACTTAACCTATT
TGCTTTGATTCTTTTGAATTTTCTCGAGAAGCCTCTCTGGTGCCGGGGATATTCTCAACA
TGCTTGTGATCAAAGGGATCTTTACTTTCTGGGGCAGTTGCCATACTTGAGCAAAACTGA
ATCTCTCATATATGAGGGGCTCACACTTGTTATTCTTGTAATGGATATCTTCTATCCACT
GTCCTATGAAGGTTTAAACCTATTCTGGAAGAACACAATAAATAAACTGAAGGTTCTTCT
TCTCTTCATCTTAGCATGTGACATACTGGTGTTTGCATTTAGTCCCCAACCTTTCAGAGT
AGCTCCTTACATCCGTGTTGCGTTTCTAATAATGAATATCAGGGAACTGCGAATGTGTGC
TGTTACACTGGTTGGTATGGTTGGGACATACCTTAATGTTTTGGCCCTTTCACTATTGTT
CCTCTTATTCGCAAGCTGGCTAGCTTATGTAACATTTGAGGATACACCACAAGGAAAGAC
TGTTTTCTCGTCATATGGTACCACGTTATATCAGATGTTTATTCTCTTCACCACCTCCAA
TAATCCTGATGTATGGGTTCCTGCTTATAAGAGCTCTCGTTGGTCCTCACTATTTTTTAT
TGTCTACGTACTTTTGGGAGTTTACTTCCTAACAAATTTAATTCTTGCTGTCATTTATGA
TAGCTTTAAGGAGCAGCTAGCAAAGCAAGTTTCTCAGGCAGACTGTACAAGGAAAAGTAT
ACTAGAGAAGGCATTTGGTATCATTGATGCTACTGGTCAGGGTTATCTCAACAAAGAACA
GTGCCTATCATTACTAGATGAGCTCAACAAATACAGATCGTTACCTAAAACCTCAAGGGA
AGATTTTGAATTAATTTTTGCCGAGCTTGATCAGAGTGGTGATTTTAAGGTTACCTCTGA
AGAATTTGCTACACTGTGCAATACCATTGCAATAAAATTCCAGAAAGAACCACCTCCATC
CTATCTCGAGAAGTATCCATCTTTCTATCATTCAGCACTGTGTGAATGGTTGAAATCTTT
TGTGCGGAGCCCACTGTTTGAGTATATTGTTATTTTTGTTCTTCTGATGAATCTAGTCGC
TGTCATTATTGAAACAACGCTGGATATAGAAAACAGCTCCTCGCAGAAAGTGTGGCAAGA
AGTTGAGTTTGTCTTTGGATGGATTTACGTTATAGAGATGGCACTCAAAATATTTTCATT
AGGATTTGGTGCCTACTGGATGGAAGGTCAAAACAAGTTTGATTTTGTGCTTACTTGGAC
TATATTTATTGGAGAGACTCTAACATTTGCCTTCCCATCGAAGCTTTCTTTTCTTTCAAA
TGGAGAATGGATTCGGTACCTTCTTCTTGGAAGGATGTTACGCTTGACAAGAATTCTGTT
GCAAGTTCGGCGTTTCAGAGCATTTGTTGCAACATTCTTTACTCTGATGTCTAGCTTGAT
GCCATATTTGGGGATTGTATTCTGCACCCTTTGCATTTACTGCTCCCTTGGTTTGCAGAT
ATTTGGGGGCATTGTGTATGCAGGAAATCCAACACTAGAAGAAACCGATCTCTTCAGTAA
CGACTATCTTCTTTTTAACTTCAATGACTATCCAAGTGGTATGGTAACTCTGTTCAATTT
GTTAGTGATGGGCAATTGGCAAGCTTGGATGGAGAGCTACAGGCAATTGACTGGAAGTTA
TTGGAGCCTGATTTATTTTGTCAGCTTTTACCTCATTTCAGTATTACTGCTGCTTAATCT
GATTGTAGCATTTGTGTTGGAGGCATTTTTTGCTGAGATGGAACTGGAGAAAGATGGCGA
AGCTGATATCCAGGATCCTACTTTGGAAGGAAGAAACAGGCGGCGATCTGTGCGTGTGAG
GACAAAGGGGACCATGGTTGATATTCTTCTTCACCATATGTTGAGCAATGAACTTGATGG
ATCTCAAAACCGTGACCAATAGCTTATCTTCATGGTCTTTTTTTTTTTTAAAAAAAAGGC
CCTGCAGGAAGAAAGCAAGAACAGAAAAAAAAAAGGAAATGATTAGAGCCGGTTCTCGAG
CATGGAGTTATGTTTTGTTATGTCAGGTACTCAGGTGCAAAGGAATCTTGGTGAGGTGAT
GGAAAGGACTCTGCTTGTCATACTTTAGTTGTCAAGGAGAACAGCAGATGTGTTCTCTTT
CTGCTCCAAAGGAGACCTTAAAGGAGCTTTTTTTTAAAAGTAAATATTGTAGGAGATTCT
CCTACAGTGCATATATATTTATACAAAGGAGCTCTTTTTGTATAGGATTAAAATGTGCTA
ATGGTTCTGGTGATTTTCTTTTTTGAAAACTTTACAGGTTATTATAGCCATAATACTCCA
CATTTCCTTATTGTTATACTATATACACGTTATAAGTTTTG

CDS

2274 bp

>Os01t0678500-02 Voltage-gated Ca2+ channel  protein, Elicitor-induced defense reponses, Hypersensitive cell death, Activation of MAPK cascade
ATGAGGGAGAGGGGAGAGATGAGGGAGGCGAAGGCGCCTCTGATCGCGGAGGCGGCGGAG
CACATATCCCATTCCCACGGCTCCGGGTCGTCCGGCACCGGCAGCCACACCAGCGGCGGC
GGCGGCGGGTGGAGGGGCTCGAGGCAGTACCAGCGCCGCTCGGACGCCCTCGCCTACGGC
AACCGGTACCAGAAGGCGGCCGCCCTCGTCGACCTCGCAGAAGATGGTGTGGGTATCCCT
GAGGATGTCTTGAATGACACAAGGTTTGAGAGGGCTATGAGATTCTATTTTGTGTATCTC
CGGTTGGATTGGCTGTGGTCACTTAACCTATTTGCTTTGATTCTTTTGAATTTTCTCGAG
AAGCCTCTCTGGTGCCGGGGATATTCTCAACATGCTTGTGATCAAAGGGATCTTTACTTT
CTGGGGCAGTTGCCATACTTGAGCAAAACTGAATCTCTCATATATGAGGGGCTCACACTT
GTTATTCTTGTAATGGATATCTTCTATCCACTGTCCTATGAAGGTTTAAACCTATTCTGG
AAGAACACAATAAATAAACTGAAGGTTCTTCTTCTCTTCATCTTAGCATGTGACATACTG
GTGTTTGCATTTAGTCCCCAACCTTTCAGAGTAGCTCCTTACATCCGTGTTGCGTTTCTA
ATAATGAATATCAGGGAACTGCGAATGTGTGCTGTTACACTGGTTGGTATGGTTGGGACA
TACCTTAATGTTTTGGCCCTTTCACTATTGTTCCTCTTATTCGCAAGCTGGCTAGCTTAT
GTAACATTTGAGGATACACCACAAGGAAAGACTGTTTTCTCGTCATATGGTACCACGTTA
TATCAGATGTTTATTCTCTTCACCACCTCCAATAATCCTGATGTATGGGTTCCTGCTTAT
AAGAGCTCTCGTTGGTCCTCACTATTTTTTATTGTCTACGTACTTTTGGGAGTTTACTTC
CTAACAAATTTAATTCTTGCTGTCATTTATGATAGCTTTAAGGAGCAGCTAGCAAAGCAA
GTTTCTCAGGCAGACTGTACAAGGAAAAGTATACTAGAGAAGGCATTTGGTATCATTGAT
GCTACTGGTCAGGGTTATCTCAACAAAGAACAGTGCCTATCATTACTAGATGAGCTCAAC
AAATACAGATCGTTACCTAAAACCTCAAGGGAAGATTTTGAATTAATTTTTGCCGAGCTT
GATCAGAGTGGTGATTTTAAGGTTACCTCTGAAGAATTTGCTACACTGTGCAATACCATT
GCAATAAAATTCCAGAAAGAACCACCTCCATCCTATCTCGAGAAGTATCCATCTTTCTAT
CATTCAGCACTGTGTGAATGGTTGAAATCTTTTGTGCGGAGCCCACTGTTTGAGTATATT
GTTATTTTTGTTCTTCTGATGAATCTAGTCGCTGTCATTATTGAAACAACGCTGGATATA
GAAAACAGCTCCTCGCAGAAAGTGTGGCAAGAAGTTGAGTTTGTCTTTGGATGGATTTAC
GTTATAGAGATGGCACTCAAAATATTTTCATTAGGATTTGGTGCCTACTGGATGGAAGGT
CAAAACAAGTTTGATTTTGTGCTTACTTGGACTATATTTATTGGAGAGACTCTAACATTT
GCCTTCCCATCGAAGCTTTCTTTTCTTTCAAATGGAGAATGGATTCGGTACCTTCTTCTT
GGAAGGATGTTACGCTTGACAAGAATTCTGTTGCAAGTTCGGCGTTTCAGAGCATTTGTT
GCAACATTCTTTACTCTGATGTCTAGCTTGATGCCATATTTGGGGATTGTATTCTGCACC
CTTTGCATTTACTGCTCCCTTGGTTTGCAGATATTTGGGGGCATTGTGTATGCAGGAAAT
CCAACACTAGAAGAAACCGATCTCTTCAGTAACGACTATCTTCTTTTTAACTTCAATGAC
TATCCAAGTGGTATGGTAACTCTGTTCAATTTGTTAGTGATGGGCAATTGGCAAGCTTGG
ATGGAGAGCTACAGGCAATTGACTGGAAGTTATTGGAGCCTGATTTATTTTGTCAGCTTT
TACCTCATTTCAGTATTACTGCTGCTTAATCTGATTGTAGCATTTGTGTTGGAGGCATTT
TTTGCTGAGATGGAACTGGAGAAAGATGGCGAAGCTGATATCCAGGATCCTACTTTGGAA
GGAAGAAACAGGCGGCGATCTGTGCGTGTGAGGACAAAGGGGACCATGGTTGATATTCTT
CTTCACCATATGTTGAGCAATGAACTTGATGGATCTCAAAACCGTGACCAATAG

Protein

758 aa

>Os01t0678500-02 Voltage-gated Ca2+ channel  protein, Elicitor-induced defense reponses, Hypersensitive cell death, Activation of MAPK cascade
MRERGEMREAKAPLIAEAAEHISHSHGSGSSGTGSHTSGGGGGWRGSRQYQRRSDALAYG
NRYQKAAALVDLAEDGVGIPEDVLNDTRFERAMRFYFVYLRLDWLWSLNLFALILLNFLE
KPLWCRGYSQHACDQRDLYFLGQLPYLSKTESLIYEGLTLVILVMDIFYPLSYEGLNLFW
KNTINKLKVLLLFILACDILVFAFSPQPFRVAPYIRVAFLIMNIRELRMCAVTLVGMVGT
YLNVLALSLLFLLFASWLAYVTFEDTPQGKTVFSSYGTTLYQMFILFTTSNNPDVWVPAY
KSSRWSSLFFIVYVLLGVYFLTNLILAVIYDSFKEQLAKQVSQADCTRKSILEKAFGIID
ATGQGYLNKEQCLSLLDELNKYRSLPKTSREDFELIFAELDQSGDFKVTSEEFATLCNTI
AIKFQKEPPPSYLEKYPSFYHSALCEWLKSFVRSPLFEYIVIFVLLMNLVAVIIETTLDI
ENSSSQKVWQEVEFVFGWIYVIEMALKIFSLGFGAYWMEGQNKFDFVLTWTIFIGETLTF
AFPSKLSFLSNGEWIRYLLLGRMLRLTRILLQVRRFRAFVATFFTLMSSLMPYLGIVFCT
LCIYCSLGLQIFGGIVYAGNPTLEETDLFSNDYLLFNFNDYPSGMVTLFNLLVMGNWQAW
MESYRQLTGSYWSLIYFVSFYLISVLLLLNLIVAFVLEAFFAEMELEKDGEADIQDPTLE
GRNRRRSVRVRTKGTMVDILLHHMLSNELDGSQNRDQ*

5'UTR

chr01:27920808..27920895 (- strand) : 88 bp

CDS

chr01:27920592..27920807 (- strand) : 216 bp

chr01:27919310..27919453 (- strand) : 144 bp

chr01:27919096..27919203 (- strand) : 108 bp

chr01:27918575..27918670 (- strand) : 96 bp

chr01:27917946..27918055 (- strand) : 110 bp

chr01:27916703..27916763 (- strand) : 61 bp

chr01:27916059..27916225 (- strand) : 167 bp

chr01:27915866..27915971 (- strand) : 106 bp

chr01:27915665..27915742 (- strand) : 78 bp

chr01:27915181..27915242 (- strand) : 62 bp

chr01:27913969..27914041 (- strand) : 73 bp

chr01:27913049..27913114 (- strand) : 66 bp

chr01:27912555..27912698 (- strand) : 144 bp

chr01:27911866..27911923 (- strand) : 58 bp

chr01:27911096..27911203 (- strand) : 108 bp

chr01:27910448..27910511 (- strand) : 64 bp

chr01:27909876..27910044 (- strand) : 169 bp

chr01:27909457..27909521 (- strand) : 65 bp

chr01:27909226..27909316 (- strand) : 91 bp

chr01:27908686..27908772 (- strand) : 87 bp

chr01:27908415..27908486 (- strand) : 72 bp

chr01:27907813..27907853 (- strand) : 41 bp

chr01:27907647..27907734 (- strand) : 88 bp

3'UTR

chr01:27907635..27907646 (- strand) : 12 bp

chr01:27906660..27907086 (- strand) : 427 bp

FASTA

>Os01t0678500-02 class=Sequence position=chr01:27906660..27920895 (- strand)
CTTCTACTTC CGCTTCCGCT CGCGGTTCCA GATCTCTCCC TGCACATCTG CATCCACTCA CACTCGAGGG AGAGGGAGAG
GGGGAGAGAT GAGGGAGAGG GGAGAGATGA GGGAGGCGAA GGCGCCTCTG ATCGCGGAGG CGGCGGAGCA CATATCCCAT
TCCCACGGCT CCGGGTCGTC CGGCACCGGC AGCCACACCA GCGGCGGCGG CGGCGGGTGG AGGGGCTCGA GGCAGTACCA
GCGCCGCTCG GACGCCCTCG CCTACGGCAA CCGGTACCAG AAGGCGGCCG CCCTCGTCGA CCTCGTCGGT TCCCTCCTCC
TCTGCCTCCC TCTTGTGTCG TTCGTACTCG TTGTTAGGCG AAGCGCGACG CTGCTTTGCT GTAGGCTGCT CCTGTGTTGG
GAATTGCGGT GATCGTGGTC GTGGGTTTGT CGGGGTGGGT GGTGTGCGCT GGCGAGCGTG GATGTAGGGG CGGTGTTTGA
TGGATTGTCT GCCCGAGCTC GGCATGTTTA CGTGGTGCGG GAGCTTGGCG TGGTCGAGGT AGTTGTTTGC AGCTTGTGCT
CTGTTCGGAG CCGTGAGATA GGGCCAAGGC GCCACTCGGC ATAGGTTGCT TGGCGATAAC CTGAACTTTG CGCACATTTA
CGTGCCAATG CCAGAATTAA GCGTGGTTTC AGTTGTGCTG TTTTATGACA GAAAACGTAC TAACAGTGTT TAAGTTGACT
TTCACTATTT CCGATGTTGC ATATAGCTGT TAACTTTTGT TTCGATTTTT GCAAGCGCTA TCTTTGAATT ATGTTAAAAA
TGTACCATCT AAAAATTTTA TCATGTGCAA ATTGACGTTT TACTATAACT GTCGTGTCAT TTGCATGTGA ATTCTCACTC
AATACCCAGT ACCATAACAA GAATATATGT TATCCGTCGA CACTCTTAGC TAACGGACTT AGCGCAGTAA ATCCCATTTT
CTTTTGCAAC ACAACTAGGG TATCTTTAAT GATGCAAAAC AAGGTCTACA TTTGTGTTTT GCGATCAGGG TTCACTCTAT
CGGTTCAGGG TTTTCTATCG GGGGTCACCG AAATCCTGAA ATTTCGGTCC AAAATTTCCG AAATTTTAAa caaaatttag
ttgaatttga acaaatatta tccaaattca tgaaaaaatt gaaaaattca aaaatttcgg ccgaattaat atcgtatcgg
gggtcacttg gaaatttcgg tccgaaattt ccaaccctgt tTGCGATATT GTTGTCATTT TCTGATGAGT TCACGTCCTC
TACCATAATA TCACTACCAT TACAGGCACT GACGTGTGGG ACAATAGGAG GATAGGACCC ACATACTAGT GATTGTAATG
GTACTGTAAT GGTAGTGACT TTATGGTAGA GGATCCTCAC CCTTTTCTGA TATACTGGGA ATTAATTGCA ATGGTTTGAC
AGGCAGAAGA TGGTGTGGGT ATCCCTGAGG ATGTCTTGAA TGACACAAGG TTTGAGAGGG CTATGAGATT CTATTTTGTG
TATCTCCGGT TGGATTGGCT GTGGTCACTT AACCTATTTG CTTTGATTCT TTTGAATTTT CTCGAGGTTA GTTATGAAAA
TGGAACCCAT CTATTACATT GTACAGGAAA GCGGCTAAAA TCCTGCAAGT CCCATTATGG TCATGTTTTG AGTTGTTTCT
TTTGCATTTC AGAAGCCTCT CTGGTGCCGG GGATATTCTC AACATGCTTG TGATCAAAGG GATCTTTACT TTCTGGGGCA
GTTGCCATAC TTGAGCAAAA CTGAATCTCT CATATATGAG GTAAGGCTTT GTCTATAAGA GTGGTGTTTC TATGTTCTCT
GAAAACTTTA ATTGCAGAAA ACTTCAAAAA CTACAGTCGG TAGTAGATTA ATGAGCAGTT GGAAAGTCAG GTCAATAATT
TGCTTTTGTA ATTACACTCA ACTTTGTTGG TGACCATTAA AGCAACCTTT GGTGACTATA CTAATCACAG CTTCTCAATA
TTATTGTTGA GCTTTGAGAT GTATTGCATA GTTAGTTGGG CCAGAGCATG GTCATTTGAG TACATTAAAA TCTGAATTCC
ATCATTCTAG ATTTTGTATG GTTATTTGTT GTATAACAGG ATAATGCACA TGCTTTTTTT AACGAACATG TAATGGTCTG
TATTGAGGAC TGAAAACATT AATCTGATAT ATTTGACGCA AACTTGCCGT TCTTTTCAAT TTCAGGGGCT CACACTTGTT
ATTCTTGTAA TGGATATCTT CTATCCACTG TCCTATGAAG GTTTAAACCT ATTCTGGAAG AACACAATAA ATAAACTGAA
GGTATGGCAT CTGTTTATAA AATAGATATA TATGAGTATA AATAGCAAGA ATAGCATACA TGTTTGTTTT TCTAAGATCC
ATTGATGTGG ATAGCATACA AGTATAAACT GAAGTTAAAT AAAACTATGT AACTGCAAAA AATAATGGAT GATGTGGATT
ACATCTGGCC CTACTGAGAT AAAATCTAAA ATTTGAAGGC ATATGTGAGT GAACATTCAC ATATTTAACT ACTTTTTGTA
AATTAACTAT GTGCTTTTAC GTATGAGGGA TGGCTATTTT TTTTGTTAGA TTTGACTAGG CCCTTCCAAT TTTTGATACA
GTTACATTCA AGCTAAATAA ACTTCCTTGT TTTAACTAGA CTACCCATTG TGCTAACTCT GCCCCTTTTA ATTCCTACGC
TGCAAACAGA CTGTAATCCT GTTGTTTTAC TTTAATTAAG CATATGTTTC TCTCTAAAAA TGTGTCTTTC TTACTGCTTC
ACAAACTGTG GTCTATCCAT ATTTCTGCTT TGTCTTGTAG GTTCTTCTTC TCTTCATCTT AGCATGTGAC ATACTGGTGT
TTGCATTTAG TCCCCAACCT TTCAGAGTAG CTCCTTACAT CCGTGTTGCG TTTCTAATAA TGAATATCAG GTTTGCAGTG
TTTTATCTAC TCTAGACTAC AGTTTCTGCT GCTAGCTTTC TGAATTCAGT ATGAAGGTTC GTTACTGAAT CAATCTCAAA
GAAAACTAGC TGGGTGGCCC GCGCAATTGC GCGGCTAGCA CCCATACAAA ATTATCTATT TTTTACATAT TATTTTACTT
AAATTTTGTT AAATAGCTAA CTCATTGTCT TAGGACTTTG AAAGACCGAA CTTTATCATC CAAGTGTTTC TAATtttata
ttttttagaa gtcacgctag tcgctacccc tttatttgtt gccgatttac caccgtttct attcatcctc ctcatttgtc
atcgttgtgt tctagatgga cttttttttt tgaaaattcc atatttttca ccctgatatt tttttattta taaattgttt
tcctacttga actcttataa ttatttttct atgtttggaa tttattttat ttgttacttc ggattttaat taatctcgtc
atgtgttctt gatggtctct tctttcaatt gtctttattt tttattaaga attttaatta tttataattg tattcctagt
tgaactctta ttttcctttt tataatttct gaatttattt tattttttat ttagatttta attaatcttg ttttgtgttc
tatatggact attctttcga tgttactttt tttttatttt aaattttAGT TGtttcaaaa ttgtattaat atttgaactc
tattttattt ttctaataat ttcttaattt attttatttt ttattccaaa ttttaattaa tcgtgtattg ggttcttata
tggactcttt ttctaatatt gcttattttt aattccaaat ttcagttatt ttaaaattgt attcctactt ggactcttct
ttctttttct ccgattaatg tggtaatttc tagcctccac aacgaacgtg gtgcctcctt tcaatgctat cttaataata
taatagATAG ATAGATGACC TAGATTTCTG CAGGATAATC ATACTGCATA GCAAAGAGAA GACCCATAAA TAATTATAAT
TAGCGTTCAC ATAGACACAT AGGCAAACAC TTACCTGTCC CATTTAGGAA AAGATACATG TCAATGTTAG TTAAGATATA
TGTTATTTTT TTGATTGTTT GACAGATGTA TTAACTGTTC CTTTTGTGAC AGGGAACTGC GAATGTGTGC TGTTACACTG
GTTGGTATGG TTGGGACATA CCTTAATGTT TTGGTAAGAC TTTATTAATT ATGCAAAATT ACTATACTTC TAGCACTGTA
GGACATACAA TGATTATATT CCTTCAGAAT AAGCCATTAG AAGTTTTTGT CTATGCTTGA GAGTCACGGG GACCTTTCGT
TACTCTCTTC ATCTGATGGT TTGTGGTGCA TGAATTGAAA TTGTGGACAC CAACTTATAA ATAGTGTGGG ACCATTGTAG
ATTTAGGTAG GCTGGGAAGG AGGGGGAGAT TGTTCTCTTC TGACATCCTG TTCATTCTTG AGTTCTGCCC TTTCTGCTTT
CCAATATAAA AGTCAATTTT GAACTACATT TTACGGCCTA GTTATTGGAA TACTAATTAC AAAGATGTTT ACCTCAATTT
ACTTTTCCAT GAGTTTCTTA TGGTTCTGCA TGTTCATATT TATGTCTGCA TTAGTGCACA TTATGTGTTC AGTTTTGATG
CATATCTTTT TGGTCGCTTG CATTATGTAG GCCCTTTCAC TATTGTTCCT CTTATTCGCA AGCTGGCTAG CTTATGTAAC
ATTTGAGGAT ACACCACAAG GAAAGACTGT TTTCTCGTCA TATGGTACCA CGTTATATCA GATGTTTATT CTCTTCACCA
CCTCCAATAA TCCTGATGTA TGGGTTCCTG CTTATAAGTA AGAAGGCATC ACTATTACTG AAGTGTTTAT GATAGTTCCT
GCATATGACA TGCATACAAA TTAACCTTAT ACATCTTTGA GCAGGAGCTC TCGTTGGTCC TCACTATTTT TTATTGTCTA
CGTACTTTTG GGAGTTTACT TCCTAACAAA TTTAATTCTT GCTGTCATTT ATGATAGCTT TAAGGAGCAG GTGGGTTCCT
CACCTCTGTC CTAATTCACA TGATGATCGC TATTTTTTTT TGTTATGAAT TCTGAGTTAT TATTATTATT ATGCTTCACA
TACTGCTAAC ATGGCATATT TTTTGTGATC TAGCTAGCAA AGCAAGTTTC TCAGGCAGAC TGTACAAGGA AAAGTATACT
AGAGAAGGCA TTTGGTATCA TTGATGCTAC TGTAAGTGTT TTCCATTTTA TGTTGTCCTG CAAACTAGTG CACCACAATT
TGGCAACGTA TTTTAGTGCA AGTATTTTTT ATGTTTTCCT GAAAACTGAT GCACCTCAGC AGTACTTCAG TACTTTAGTA
TAACTTTGAT GTTCAGGTTA TCCTTCATCA GAGTATAGTC TGATCACTTC GGTTCTCAGT TGGGATTATT TTAAATGTTC
AAATTATCAA ATAAGCAGCA CTAGCTCACC TTCGCAAGGC GTGATGAGAT TAATATTATA GATCTTAGAT TAGGGAAAAC
GAGTTAGCAA GAAAATCAAG GTCCTGCTGC TATTGAGATG ATATAGACGT GTTTAGTTGT TTGGCTGTGT TATTCATGAG
TATTATTAAT ATTGGCTGCT GATATCCCTT TCTTCCCTAT CTGTGGACAT CAGGGTCAGG GTTATCTCAA CAAAGAACAG
TGCCTATCAT TACTAGATGA GCTCAACAAA TACAGGTAAC CAAAATGCCC TCTTACATTA CACTCCTTCA AATCTCCTTA
TTACATTATA GAGTGATTTA GTCCTTGAGG GGGTACCATA CCTTTTAGTA TTAAATTTGT GCtaccttca ggtacctcaa
cttaaatttg tgctaccttc aagtacctca acacaaggga ggtaccaaaa atttacactg aaaatacagt acctcccggt
acatcctcaa ggaatgtaaa CACTGCATTT TATGGGTAGT AAGTTTATTT TTACAATCTT TTTTGTGGAG ATGTTCCTCC
ATTTCCTGAA GGAATCTTAA GTCAGTCAAA ATCAATATCT GTCATGCATG AAACCAATCT TCAAAATTAA ATCCATAGTA
GGTAAAGTGG TTAGCAAACG TGCTGAAGGA GATCCCACCC AACCCAGATG CCAACAAAAT TAACTCCATG TCCATGCCAA
GGGTATAAGA AGTCTCTAAT TGCCCCACTT CCGTGCAAGC TTGATGCTAT CTGTGAAAGT GGCCGATCCA TTAAGGAAGG
TCTTTTTTTT TTTATCCTTA CACTGAAAAC TGAAAAGGGT AACTAACTCA TGCAAATGGT AAGCAAAAGA AAAACCCTTT
AAACAATGAC GTGACTGCCT TTGGAAGATG GGCATCCTTA CTGGTCTGTA GAGCCAAATA TCCATTTTTA TGATGATGCA
CTGGTACTTG AATACTCATT AGATGACATG CCATCTCGAA GAGAACACAG GTCAGAATGG GTGTCTGCTT TCGTTATTAC
AATCTCAATG CTATTCCAAA TTACATTATT TCAGTTTTGC TCCATTATTT TGACATTCAT AACATATATC AGAAATCAGC
AGAATTAATT GTGTAGAAAA TGTCAAATTA ATATCTAGAA GCCTAGAACA TGGTTCTTAC AATTGCAGCA TATCATGCTG
TCCACTTTTC GGTTTTGCAT TTATTGATTT TATTGAACCA ACAACTTAAT GGTTTGTAAG TGTAAGTTAG TTTTGCTTAT
TATCATAACA TGGTAGGGAG ACATCCCTTC CCCTCCAAAG TTGATGACGA CAGATGTTAT CCTTGCATTT TACCAAATTC
CTGCTAGCTC CTGGATCAGT TATGGGTCTC ACAGAATGGT GCCTCCTTTT GTAGATCGTT ACCTAAAACC TCAAGGGAAG
ATTTTGAATT AATTTTTGCC GAGCTTGATC AGAGTGGTGA TTTTAAGGTA CGTGCTCCTA CTATCTTCAG TAGGCATGTC
TTAGTTTTAA TAATTCTTCA AGCACGTTCA CCCTCCATCC TCTCCCCCTA AGCCCCCCCC CCCCCCCCCC CAAAAAAAAA
AGTACTTGTA AGAATGTTTA TAACAAAAAC ACTTAAGGCT GTGTTTAGTG GTGGTTGGAA ACCTTTTCCC TCCGCacgga
aaatgaggta gcacattagc acatgattaa ttaagaatta gctaaaaact taaaaatgga ttaatatgat ttttaagcaa
cttttctata gacttttttt ttggtgcaaa aaagcaccat tcagtagttc gggaagcatg ctcatgggaa acgagGGAGT
AGAGGTTGGG AAACTTGAGT TCTGAACGCA GCCTAAGAAG CTGGTACTAA ggccatcccc aacccagaaa ctatcaaata
gtttccgtac ttgctatgtc atatagacac tatgtataga aactacaatt caatggatgg tgtcttcaaa ttaaattctc
atccaatcac ctctcttctc tctcctttta tctacctatc cccttgtttt cattcttggt tcttgtgtag agatggtttc
ttgcatgaga aatggtttat tcatcttttt acctctctcc tctttagctc tcttgccaca tcagattttt gcttatgtgg
caatgcatta aatgctatgg agactagatg gcatggttgg ggatggccTA ATTATCACCT GTACCATTTT CTGAAAGTAT
ACATGCCTCA GTGAGGTCTT AATTCTGATG TTAATTTTTA TCCTCATTTG ATGGTATGGC ATGTTAGTGT TTTTTTATCT
CACTTATTTA TCCTTGTCCA GGTTACCTCT GAAGAATTTG CTACACTGTG CAATACCATT GCAATAAAAT TCCAGAAAGA
ACCACCTGTA AGTTGTACTT ATTTTGATGT TCATAATTTT CTACTCTTTC TTTATCATGG AAAATTGAAA GCTATACTCC
TTCAACCTAA AACAAATACC CTCTATTTGA CTTGCCACAA ACCCCAATGC AAAATCTTGG CTGTTATTTT ATTGTTACTT
TTAGCAAAAG TTTAAGGAAA TGTTTTGTGA CATTATGTTT TTGCCCTTCC CTTGTTTACA CAATCTGAAT ACTTCAATTG
CAAATGTATC AATGACCAAA TATTGTTAAG AGTGTCAAGG ATATAAATAC GTCGATGTTG CACTGTTTGC AGCAACATTC
TACCTTGTTT GACCTAATGT TGTACATATT TTTGCAGCCA TCCTATCTCG AGAAGTATCC ATCTTTCTAT CATTCAGCAC
TGTGTGAATG GTTGAAATCT TTTGTGCGGA GCCCACTGTT TGAGTATATT GTTATTTTTG TTCTTCTGAT GAATCTAGTC
GCTGTCATTA TTGAAACAAC GGTATGGCAG TTTTTTTTTC TTCTAATTTG TGTTTTATTT TTATTCAACT TGGAATCATA
CTTTATATTG TTAGCAGTAT TCTATTTCCA TATCTGCTAG ACTTAAATTT ATACTCTTAG CACTTCTCAG TATTTGTTTT
CTATTTTTTG TTTACTATCA ACTACTGAGT ACATGGCAGC GTAATCAGCC TACTATATTA GCTTTGCAAT AGTTTGTTGA
CTACAAAATT ATTCAATCTA AGTTATCTAT GCTAATATAA AAGATGGTAA TGGTGAGTCT ACCACCACCA ACACCTGACC
ACCCAACTAC CATGCGGGAC CTACGAACAG TGAGACAAAA CTTTGCTTGT TTCCCAGCCC CCACATGCTA TAGACCCCAG
CGCAAGGAAA ATATGACAAT AGAATATTAT GGATTTTTTC ATCTTTGTGA AATGACAACA AAATTAGCAC AATGATAATA
TATTAGACAA TTAGAAACAA ATTTTGTTGC AACATACGGG CATTATGCTA GTGTTTAACA ACGTTTTGTA GACAAGGAAG
CATGGCTTCA TTTTAGAACC AAGAATTGAA ATAATTAAAT TCACAAACGG ATGTGAAAAC TGTATGTAAT CCCTGGGATA
TGATTTTTGC AGCTGGATAT AGAAAACAGC TCCTCGCAGA AAGTGTGGCA AGAAGTTGAG TTTGTCTTTG GTAAGCATAT
TTTGGTGAAC TTTGTTTCAA CAATGCTCTG TAAGCAGTAA CTATCTCCTA TAAAATCTCC CTGGCATATT ATCTTGAGTT
TCCAACTTAA AGTTGACACT TGAAGAATAA TTGCCATTTC TCTTAGGTTT GATGATTATG TAGCCGAACT TCAGAATTTG
TATTCTACTG TAGTAGTCTG TCGTTCTTAA ATTTTGTTGA AAGGGTCTAC TGTGTTTTCC TGATTTAGGT TGCTGCAGTA
CTGTGGGGTC GATACAGAAT CGCATATGAT TGCAATGGTC ATAAGTTTAT TCCCTCTATT TAGAAATGTA TATTGTATCA
GAAATCATGT AATCAAACTT CTTACACTGT TTTCACATCC GTTTGTGAAT TTAATtattt caattcttgg ctgtgtacat
ctgtttggat gtagaggccg gtttaatcca tcatcttaaa aaaaAGTTCT TACACTGAGG TTTGACACAA TTAAATTCGT
AGTTTATTGA ACTTCACGAG TATATTCATA AGAAAGTACC CATTCTGTCC TTTTTTTATA AGGTGCATAT GGTGCACGAT
GTTATGGAGT GCTGGCATTG TAATGTAATA ATATGTTCAT ATCCTTGTCT TCACGTATGT AAGTATGTCA ATACAAATCT
ATAATGTTGC AGGATGGATT TACGTTATAG AGATGGCACT CAAAATATTT TCATTAGGAT TTGGTGCCTA CTGGATGGAA
GGTCAAAACA AGTTTGATTT TGTGCTTACT TGGACTATAT GTAAGTTAAT CCTACTAATT TATTTTGAGA CGATTTTAGT
AACAGTTCTG TGTAGTTGCT TATTTTCTTC CATTGCTACT TTTCACCTTG CATTTTAAAG AAAAATCCAT ATTACCAAGA
AGTATTTCTG GTTCAAAAGA AGAGTTGCAT TTCACAACAA AACTGAATTA GAAAAATATT GTATGGGTGA GAGGTTATAT
TTTAAGAATA CTATATTTAA GAATAGGTGT GTGCATTCAC TGTTACTGAA AAACTATGGA GTATAATTGA TTTTCCCTTG
GTCATGATTG GATGATGATA AACTCTCAAC TTCAAAACCA TGTTTCCTTT CCAAGAAAAT AACACTGGTC ATATCAAATG
CGTTATGTTC TTCAAATTTA GCTTTTGCCT AACCTGGACA ACCAAATATT CTTGTTCCAT GCAGTTTCCG CTGAAAATAA
GTAAATAACT AGTACTGTAT ATTCAACTGC CTTAATTCAT ATCTGAAAAG GAGTATCGTT GGAAGAGAAC TTTTTTTTTT
TTTTTGCATA TAGTAATCTT CTTGCCAATT ACTTTGTGGC ATCTGACTTC TCATTTCATT GTAGTTATTG GAGAGACTCT
AACATTTGCC TTCCCATCGA AGCTTTCTTT TCTTTCAAAT GGAGAATGGT AATTTCACTG TTTTGGATGC TTTACTTTCC
AAAATTTAGT CAATCCATCA TATGTACATC AAGATACAAA CATCAATCCT TTTAGTATGC ATCATGCTCT TTAATTGCTG
AAACTAAATt aataacctct ttcctaatat gatggtgatt taagaactat gtacttaagt tACCATGTGA ATAAAAAATA
AACTCTAACC TGAAATATCA TGTTGAGCTA TATGGGTTGT TGAATCTTAA TAATTGCCCT GAACTTTACT TTGAATCATC
ACTTTAACAT TAAGTCACTT AAACAGGTTC TGAGTGGATA ACAGTTCTGA CAGAATTCTC TGTTAACTAT TTATCGTTGT
TTACTGCCTT GCTCTAATAA TCCTGATTTT CCTCTGAATT TTGCCTGGCA GGATTCGGTA CCTTCTTCTT GGAAGGATGT
TACGCTTGAC AAGAATTCTG TTGCAAGTTC GGCGTTTCAG AGCATTTGTT GCAACATTCT TTACTCTGAT GTCTAGCTTG
ATGCCATATT TGGGGATTGT ATTCTGCACC CTTTGCATTT ACTGCTCCCT TGGTTTGCAG GTTGGAATAA ACTAATGGTT
TTCCATATCA AGTTTAATGT CCTAAATAGT TCATCCAAGA GCTTAAAGTT TTTGGGGAAA CATAAATATT TGTGCTCATT
CTTCAGTGCT TCCCCTCACA TGCAGTCTTG ACAAAATTGC TGGTCCAGTT TGTTTACTGG TCACAGCAAT CTGTTACTTA
CACTAGTGAT TGGAGTTCCT TTTCTTTGTT CTTAGATTGT CCAGTTACTA ATTACTATTG TTATTTGTAC TTTTCCTTGT
CTAAACAGCA CGTCATTGCT GTCTATATAT CATAAACACT TTTCACACCT CAATTATTGT CATTAGATGA CAGTCTCGAG
TCTTCTGTTT GCAGATATTT GGGGGCATTG TGTATGCAGG AAATCCAACA CTAGAAGAAA CCGATCTCTT CAGTAACGAG
TACCCTTTTT GTTCTTATTT CACCGTTTTG ATTTCTAAAA AGTTTTAGAA GTGTTTTTGT TCCAGTAACT TCTATACTAA
AATCTCACCT TCTATTTATT TTTGACAAAA TTCTCACTCT TTTACCTTGG CATGTGCAGC TATCTTCTTT TTAACTTCAA
TGACTATCCA AGTGGTATGG TAACTCTGTT CAATTTGTTA GTGATGGGCA ATTGGCAAGC TTGGATGGAG GTAAGAACAT
GGCAGCCATG CATGTGCTCA ATCTTGCTTG TTCTATACAC TGAATATTTT ATATTTTGAG GGGTGAGAGG GTGGTTTTGT
ATGCACTGAT TTACTTTACT ATTTTTCACC TTGATAAGTT GACTCATGTA GAGCCTGCCC ATTTTACTGT ATCCAAATGA
ATGCTTAAGA TCTGTGAAAT TAAGTTTAAA AGTTTACCCT ATAGATGTTA AAAAGTATGC AACTAGAAAA AAGATAGTTA
AGAGTAATAA ATCAGAAGGA AAAGGATAAT ATTTTCTCTC TTATATTTAT ATTCTTATAA ATTTAGCTCA TTGATCTGGA
TCATCTGCCT ACAATAATTT AAGTAAAATC TGCCAAAATG TCTTGAGTGA CTTATTTTAT TTGCTAACCT TCGTTTCCTT
ATCTTTGTTC TTTTGAATGA AGCTCCTTTT TTCTTTCTTT CAGAGCTACA GGCAATTGAC TGGAAGTTAT TGGAGCCTGA
TTTATTTTGT CAGCTTTTAC CTCATTTCAG TATTACTGCT GCTTAATCTG GTAAGATATT AAATAGTTAT TTCAGTTTTT
GTTCATGCAG TGACATTCAT GGCATTTCTA ATATTGCATG ATACTGTTGT TTTTATTATT TATGTGCATG CAGTTAGAAA
GTTGTTGACA TTCCTATTAT CCTACTTATA TTTTTTAGAT GATTATTTGT TGATTAAATA AATTGTGTCC TCCCTTTTTT
TTCCCTCAGA TTGTAGCATT TGTGTTGGAG GCATTTTTTG CTGAGATGGA ACTGGAGAAA GATGGCGAAG CTGATATCCA
GGTTAGAACA ATATTTGTGC CGACAACAAA TTCTCTTTAC TTGTATTTAG AAAACTGCTG AAAAGCCAGT AATTAACTGG
TTACAGGTAG CCTAGTTGTC CTTTGACAAC ATCGATTCAC ACTACACTAT TATCGCACAA TTATTTGAAT AAGTACGAAT
CGAAACCTTG CCAGTGTTGC CTTAGGTGAG TTTGAGCAGC TGAGGGATGG TTGAGGCTAA CGTTTGGTTT GTAGTTGCAC
TTTCTGAGCC AGCTTGCCAG TTGCCATTTG GTTGTGCGCT CATGTCATGT GTCATCTCCA AATTGTGGCT AAGTGTGGGA
ACCAATCAAA CGACTCATGA ATCCCACTTC TCTTGAGCTT TTGATTGGAA GTAGTACTAT ATCTGTTTGG TTGTTTCTAA
CTTTCTGTTA TGTCAAATCA AGAAAGAATT TGGCGTTACT AGCTTCGCCT ACACAAACTG TGGATTATAA AGTATAAAAT
AACTTTAGTT TGTATAAACT TAAGCAGTTA CCTGGATTGA AATAGCTAGT AGTTTTTTGA GGGCATCTGT TCATCCATGC
AGGATCCTAC TTTGGAAGGA AGAAACAGGC GGCGATCTGT GCGGTAATAA AAGAAAACGA TTAGTTGTTA TGGCATGATA
ACATATTTCT GCAACATTAA TTTACCATTG ATGTTGTGCA GTGTGAGGAC AAAGGGGACC ATGGTTGATA TTCTTCTTCA
CCATATGTTG AGCAATGAAC TTGATGGATC TCAAAACCGT GACCAATAGC TTATCTTCAT GGTACTACCC TGTTTTTCTC
TCCAATGGCA ACTCCCGTAA AATTAGATGA CCGAATACAT GATTTGAAAA TGCTACCAGC CATTTCTAAT ATTTCTGATG
CCTATACCAT GTCACTGTGT GCTAATGTAT TTTTAGTTTT TTACTCTAGC ATAGGTAATC GGTATTACTG TATTAGATCA
GCCGATCAGC CACATCATTT GCATTCTTGC GTTCTATGCC TTCCATTTAA ATCAAGGGTg tagctatatt tatggtgcca
tatttttcat caaaaaatag tcggcatgta tttacattgt aagtccctaa attacatatg taattttagt gtatttacaa
tgtaagtctc aaaattacat atgtaagtac taaaattaca tatgtaaatt caaaaattac atactaatta catatgtaag
tGGGGTGTAA ATGAGGTGTA ACTACTGTGT AAGTGGCTGA AAAAAATCGA CTATAGCATA TGGCGCCATA TTTCTAGCAA
CTCCGTAAAT CAATTGCTTC TTTTACCATG ATTAATATTT TTAACTCAGG TCTTTTTTTT TTTTAAAAAA AAGGCCCTGC
AGGAAGAAAG CAAGAACAGA AAAAAAAAAG GAAATGATTA GAGCCGGTTC TCGAGCATGG AGTTATGTTT TGTTATGTCA
GGTACTCAGG TGCAAAGGAA TCTTGGTGAG GTGATGGAAA GGACTCTGCT TGTCATACTT TAGTTGTCAA GGAGAACAGC
AGATGTGTTC TCTTTCTGCT CCAAAGGAGA CCTTAAAGGA GCTTTTTTTT AAAAGTAAAT ATTGTAGGAG ATTCTCCTAC
AGTGCATATA TATTTATACA AAGGAGCTCT TTTTGTATAG GATTAAAATG TGCTAATGGT TCTGGTGATT TTCTTTTTTG
AAAACTTTAC AGGTTATTAT AGCCATAATA CTCCACATTT CCTTATTGTT ATACTATATA CACGTTATAA GTTTTG