Os01t0681900-01

Locus

Os01g0681900

Description

Glutamate synthetase, Primary ammonium ions assimilation in seedling roots, Development of tillers, Tolerance to nitrogen-limitation

RAP-DB Gene Symbol Synonym(s)

OsGOGAT1, NADH-GOGAT1

RAP-DB Gene Name Synonym(s)

Glutamate synthetase 1, NADH-dependent glutamate synthase1

CGSNL Gene Symbol

GLT1

CGSNL Gene Name

NADH-DEPENDENT GLUTAMATE SYNTHASE 1

Oryzabase Gene Symbol Synonym(s)

OsGLT1, OsNADH-GOGAT1, NADH-GOGAT1, OsNADH-GOGAT, GOGAT, NADH-GOGAT, OsGOGAT1, GOGAT1, OsGLU1

Oryzabase Gene Name Synonym(s)

NADH-glutamate synthase 1, glutamate synthase, NADH-glutamate synthase, NADH-Glu synthase, Glutamate synthase (NADPH) small chain, NADH-dependent glutamate synthase1, NADH-dependent glutamate synthase 1

Transcript Evidence

AK241610 (truncated)

AK105755 (truncated)

AB008845 (Sasanishiki)

Protein Evidence

Q0JKD0

Literature

PMID: 32369636

PMID: 20213442

PMID: 9748637

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

May 7, 2020

Gene Ontology (GO)

Biological Process: glutamate biosynthetic process (GO:0006537)

Biological Process: nitrogen compound metabolic process (GO:0006807)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: FMN binding (GO:0010181)

Molecular Function: glutamate synthase activity (GO:0015930)

Molecular Function: glutamate synthase (NADH) activity (GO:0016040)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the CH-NH2 group of donors (GO:0016638)

Molecular Function: oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor (GO:0016639)

Molecular Function: flavin adenine dinucleotide binding (GO:0050660)

Molecular Function: iron-sulfur cluster binding (GO:0051536)

Functional domain (InterPro)

Nucleophile aminohydrolases, N-terminal (IPR029055)

Aldolase-type TIM barrel (IPR013785)

Glutamate synthase, alpha subunit, C-terminal domain superfamily (IPR036485)

Alpha-helical ferredoxin (IPR009051)

FAD/NAD(P)-binding domain superfamily (IPR036188)

Glutamate synthase, eukaryotic (IPR012220)

Glutamate synthase, NADH/NADPH, small subunit 1 (IPR006005)

Glutamine amidotransferase type 2 domain (IPR017932)

Glutamate synthase, central-N (IPR006982)

Glutamate synthase domain (IPR002932)

Glutamate synthase, alpha subunit, C-terminal (IPR002489)

Dihydroprymidine dehydrogenase domain II (IPR028261)

FAD/NAD(P)-binding domain (IPR023753)

Full-length cDNA

J065185O03(truncated) (Online Clone Ordering)

001-202-C08(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os01t0681900-01)

TENOR (Os01t0682001-01)

RiceXPro (AK105755)

Others

Oryzabase (9311)

KEGG (Os01t0682001-01 (EC:1.4.1.13, EC:1.4.1.14))

Transcript

7040 bp

>Os01t0681900-01 Glutamate synthetase, Primary ammonium ions assimilation in seedling roots, Development of tillers, Tolerance to nitrogen-limitation
CGGGAAGAGACCCGCGAGAGAGGCGGCGCCCCGTTTCGTCCCCAAAACCGATCCATTCAT
TCGccaaccacgccgtccgccgcgtcgccggtagagaaggccgccgtgcgtgcgggagag
aagggggaagcacaaaccgcgctcggggacgagagccgcgaggcgaaggtgtggggagga
tcgggacgcggcgtcggcGTCGGTCTCACCTCCGGGCTACAAGAGCGAGAGGTAGCAGAG
GGAGAGTCGTGAGGTGCAGCCATGTCGGCGGCGCAAGGGATGGCCTACAAGCTCCGCACC
GACGCGGCGCCCACGGGCGCTGGCCGCAGGGCTCGGCGCAGCCACTCCTCCGTGGCGGCG
CCTTACCGCGCGGCTAGGCTGGTACAGGGCGGCGTGTCCATCGAGGGCGGTTTGGTCGGC
GGATGCCAGCTCACCGAGGAGCGCGTCGCCGCACGGCCGCCCCGCGCCGCCGCGCGCGAC
GCCGAGCCGGTCAGGCCACTTTCGACGCTCCCCGAGAGCAGCATTGGGCTGTACGACCCC
TCGCGCGAGCGCGACTCGTGCGGCGTTGGTTTCGTCGCCGAGCTGTCGGGCGATTACAAG
CGCGCGACGGTCAATGACGCCCTCGAGATGCTTGAGAGAATGGCGCACCGTGGTGCCTGC
GGCTGTGAGAAGAACACTGGCGATGGTGCCGGCATCCTTGTGGCTCTACCGCATAACTTT
TTCAGAGAGGTGACAAAGGATGCTGGGTTTGAGCTACCGCAGCCAGGCGAGTATGCTGTC
GGTATGGTCTTCCTGCCAATCGATGAGAAGCGCCGTGAGCGGAGCAAAGCTGAGTTTCAG
AAGGTAGCGGAATCGCTGGGACATGTAATACTTGGGTGGCGCCGGGTTCCCACTGACAAC
TCAGACTTAGGTGAATCTGCGCTCCAGACTGAGCCAGTTATTGAGCAGGTTTTCCTCACC
AAAAGTTCAAGTTCGGAGGCTGATTTTGAGCAGCAGTTGTATATCCTGAGGAGGCTCTCG
ATTCTATCTATCCGTGCAGCTCTGAATCTCCGTCGTGGAGGAAAGAGGGACTTCTACATG
TGTTCTCTCTCCTCAAGGACTATTGTCTACAAGGGCCAGCTTAAGCCATGCCAACTTAAG
GGGTACTACTATGCAGATCTAGGTCATGAAAACTTCACAAGTTATATGGCTCTGGTTCAC
TCAAGGTTCTCCACGAACACCTTCCCCAGCTGGGACCGTGCACAGCCGATGCGTGTATTA
GGTCATAATGGAGAGATCAATACCCTCAAAGGGAACAAGAATTGGATGAAAGCACGAGAA
GGTCTCTTAGAGTGTGAGAAGCTTGGCCTAACAAAGGATCAGTTTTCAAAAATTCTACCA
ATTGTGGATGCTACCTCGTCTGATTCAGGTGCTTTCGATGGTGTTCTTGAACTTCTTATC
CGTGGTGGAAGAAGCCTGCCAGAAGCTGTGATGATGATGATACCTGAGGCATGGCAGAAC
GATGTGAACATGGAACCTGAGAAGAAAGCTCTCTATGAGTTCTTGTCTGCCCTTATGGAG
CCTTGGGATGGACCTGCTCTAATATCTTTTACTGATGGCCGTTACCTTGGAGCCACCCTG
GATCGCAATGGGTTGAGGCCTGGTCGATTTTATGTGACACACAGTGGACGTGTAGTCATG
GGAAGTGAAGTTGGTGTTGTTGATGTTCCTTCCAAAGATGTATTGAGAAAGGGTAGACTA
AACCCTGGAATGATGCTGTTGGTTGATTTTGAGAACCATACTGTAGTGGATGATGAAGCA
TTGAAGGCACAGTACTCGAAAGCTCACCCATATGGGGAGTGGCTCAAGAGACAAAAAATA
TACCTCAAAGACATTGTAGAATCTGTGCCAGAAACTGAGAGAGTTGCTCCTGGAATTTCT
GGTTCACTCACACAAAAGAATGAGAAAAAGGAACATGCAGGCGTCAATGGGATTGTGACT
CCACTAAAAGCCTTTGGATACACAGTTGAAGCCCTTGAAATGCTGCTTCTCCCGATGGCT
AAAGATGGAGTTGAAGCTCTTGGATCCATGGGAAATGACACACCCTTGGCAGTCATGTCA
AACAGAGAGAAGTTGACTTTTGAGTACTTCAAACAGATGTTTGCACAAGTTACAAACCCG
CCAATCGACCCAATTAGGGAGAAAATTGTTACATCTATGGAGTGTATGATTGGGCCAGAA
GGTGACTTGTTGGAAACAACTGAAAAGCAATGCAACCGCCTTGCACTTGAGGGTCCTTTG
GTGTCGATTGATGAAATGGAGGCTATTAAGAAGATGAACTACCGTGGTTGGCGAAGCAAG
GTGCTCGACATAACTTATCCAAAGAAGTCTGGAAGGAAGGGCTTGGAAGAAACTTTGGAC
AGAATTTGCACAGAAGCTCGGGGAGCTATAAAGAAGGGCTACACTGTTTTAGTTCTCTCA
GATAGAGGATTTTCCTCAGACCGTGTTGCTGTCAGTTCGCTCTTAGCAGTTGGCGCGGTA
CATCAGCATCTTGTGGCCAATCTTGAGAGGACGCGCGTAGGTTTGTTGGTGGAGTCTGCT
GAACCTCGTGAAGTGCACCACTTCTGCACCCTTGTTGGGTTTGGTGCTGATGCTGTATGC
CCTTATTTGGCTATCGAAGCAATTTGGTGCTTGCAGAATGATGGGAAGATTCCTCCTAAT
GGTGATGGGAAACCCTACTCAAAGGAAGAACTTGTCAAGAAATATTTCTATGCTTCTAAC
TATGGAATGATGAAAGTTCTTGCAAAGATGGGAATTTCCACCCTTGCATCTTACAAAGGT
GCACAGATTTTTGAAGCTCTTGGCCTTTCCTCTGAAGTCATCCGTAAGTGTTTTGATGGT
ACACCTAGCCGAATTGAAGGCGCCACTTTTGAAATGCTTGCACGAGATGCTCTACGTCTT
CATGAGTTGGCATTTCCATCAAGAGCACCTCCACCAGGAAGTGCAGATGCAAAGGCCCTT
CCCAATCCAGGGGACTACCACTGGAGGAAAAATGGTGAAGTCCACCTCAATGATCCCCTT
GCAATGGCAAAACTACAAGAAGCTGCTAGAGTAAACAGCCGGGCAGCATACAAAGAATAT
TCTAGGCGTATTCAGGAGCTCAACAAAACCTGCAACCTGCGTGGTATGCTTAAATTTAAA
GACACTGCTGACATGATTTCTGTGGACGAGGTTGAACCTGCAAGTGAGATCGTTAAACGC
TTTGTTACTGGTGCAATGAGTTATGGATCCATTTCTTTGGAAGCACATACTGCCCTTGCT
ATGGCCATGAACAAACTTGGAGGGAAATCTAATACAGGTGAGGGAGGGGAACAGCCTTCT
CGTATGGAACCACTTGCTAATGGTTCAATGAATCCAAAAAGAAGTGCAATCAAGCAAGTT
GCCAGTGGAAGATTTGGAGTTTCAAGCTATTATCTGACTAACGCTGATGAACTGCAGATA
AAAATGGCTCAGGGTGCTAAGCCTGGTGAAGGTGGTGAGCTTCCAGGCCACAAGGTTATT
GGTGACATTGCGGTTACAAGACACTCTACTGCTGGTGTAGGACTGATTAGCCCACCTCCT
CACCATGACATATATTCTATTGAGGATCTTGCACAACTTATCCACGACCTTAAGAATTCA
AATCCTAGAGCTCGCATAAGCGTCAAGCTAGTTTCTGAGGCTGGTGTAGGAGTTGTTGCT
AGTGGTGTTGTAAAAGGACATGCAGACCATGTCCTTATATCTGGCCATGATGGAGGGACG
GGAGCTTCTAGGTGGACAGGTATTAAAAATGCTGGCCTTCCATGGGAACTTGGATTGGCT
GAGACACATCAAACTCTAGTGGCAAATGGGCTTCGTGGCCGAGCTATTCTGCAAACTGAC
GGGCAGTTAAAAACTGGCAAAGATGTAGCTGTTGCTTGCTTACTTGGCGCAGAAGAATTT
GGTTTCAGTACTGCTCCGTTGATCACACTTGGTTGCATCATGATGCGGAAATGTCATACC
AACACTTGCCCTGTTGGTATAGCTACTCAAGATCCAGTGCTACGAGAAAAGTTTGCTGGA
GAACCAGAGCATGTTATCAACTTCTTCTTCATGCTTGCTGAGGAGCTAAGAGAAATCATG
TCTCAGCTTGGCTTCCGTACCATTACTGAAATGGTTGGGCGCTCTGACATGCTTGAGGTT
GATCCAGAAGTAGTGAAGAGCAACGAGAAACTTGAGAACATTGATCTCTCATTGATTTTG
AAACCAGCTGCAGAGATTCGCCCTGGGGCTGCTCAGTACTGTGTTGAAAAGCAAGATCAT
GGTCTTGACATGGCATTAGATAACAAACTCATAGCTTTATCAAAAGCTGCACTTGAGAAG
GAAGTTCGTGTTTTCATTGAGACTCCAATCCAGAATACTAACCGAGCAGTAGGCACTATG
CTTAGTCATGAAGTCACAAAGCGTTATCACATGAAGGGATTACCTGCAGGTACGATTCAT
GTGAAGCTCACTGGAAGTGCTGGTCAAAGTCTTGGCGCTTTTCTCTGTCCTGGAATCACC
CTTGAGCTTGAAGGAGACAGCAATGATTATGTTGGCAAAGGATTGTCTGGCGGAAAAATT
GTTGTCTACCCACCAAGAGATAGTACATTTATTCCAGAAGACAATATTGTAATTGGTAAT
GTGGCTCTATATGGTGCTACTATAGGAGAGGCATATTTCAATGGAATGGCTGCAGAAAGG
TTTTGCGTGCGCAATTCAGGTGCTCAAGCTGTGGTTGAAGGAATTGGTGATCATGGGTGT
GAGTACATGACAGGGGGTACTGTGGTTATCCTTGGTAAAACAGGAAGAAACTTTGCTGCT
GGGATGAGTGGAGGCATTGCTTATGTTTATGATATTGATGGGAAATTCAGCGTCCGCTGT
AACCATGAGTTAGTTGATCTCTATCATGTGGAGGAAGAGGAAGACATTACCACATTGAAA
ATGATGATAGAACAACATCGACTTAACACTGGGAGTGTTGTTGCTAGAGATATACTCTCT
AATTTTGATACTCTTCTTCCAAAATTTGTCAAGGTATTCCCAAGAGATTATAAGAGGGTT
TTGGACAATATGAAGGCTGAAAAGGCTGCTGCTAAGCTTGCAAAGGAACCAAAGATTTCA
AATGGTGTTTCTGTAACCACTAAGAAAGTGCAACCGGAGCAATCAACAAACCGACCAACA
CGTGTTTCCAATGCCAAAAAGTACCGAGGTTTCATTTCATATGAGCGAGAGAGTATTTCT
TACCGGGATCCAAATGAGCGTGTAAAAGATTGGAAGGAAGTTGCAATTGAATCAGTGCCA
GGGCCACTACTGAACACACAGTCTGCTCGTTGTATGGATTGTGGAACTCCTTTCTGTCAT
CAGGAAAGCTCAGGTGCTGGCTGTCCTCTTGGAAATAAGATTCCAGAGTTCAATGAACTG
GTTCACCAGAACAGATGGCGTGAAGCACTAGATCGTCTGCTTGAGACGAACAACTTCCCT
GAATTTACTGGAAGAGTATGCCCTGCTCCCTGTGAGGGATCATGTGTTCTTGGCATTATT
GAAAATCCAGTATCTATCAAAAGCATAGAATGTGCGATCATAGACAAAGGTTTTGAAGAG
GGATGGATGGTACCGCGGCCTCCACTTCAAAGAACAGGAAAGAAGGTTGCCATCATTGGA
AGTGGTCCGGCTGGTTTGGCTGCTGCAGATCAACTAAACAAAATGGGCCATTTTGTTACT
GTGTTTGAACGTGCTGATCGTATTGGTGGTCTGATGATGTATGGAGTGCCAAACATGAAG
ACAGACAAGATTGAAATTGTGCAACGCCGTGTCAATTTAATGGCAGAAGAGGGCATTACA
TTTGTAGTGAACGCTAATGTAGGCAGTGATCCTTTGTATTCAATTGAGCGCCTCCGTTCT
GAGAATGATGCAGTCATTTTGGCTTGTGGAGCTACTAAACCAAGGGATCTAGGTATTCCT
GGACGCGAGTTATCAGGAGTTCATTTTGCCATGGAGTTCCTCCATGCAAATACGAAAAGT
TTACTTGACAGCAACTTGGAGGATGGTAGATACATATCTGCCAAGGGGAAAAAGGTTGTG
GTTATTGGTGGTGGTGACACAGGCACAGATTGCATTGGTACATCTATTCGGCATGGTTGC
ACCAGCATTGTAAACCTTGAACTTCTTACCAAACCACCAAGCAAGAGAGCAGCTGATAAC
CCATGGCCACAGTGGCCTAGAATCTTCCGTGTTGACTATGGGCACCAGGAAGCATCTAGT
AAGTTTGGAAATGACCCAAGAACTTACGAAGTCCTGACCAAGCGTTTTATTGGTGATGAA
AATGGAAACGTGAAGGCCCTTGAGGTGGTCCGGGTCAAGTGGGAGAAAGTCGATGGGAGA
TTCCAGTTCAAAGAAATTGAAGGCTCAAACGAGACCATTGAGGCTGATCTTGTCCTCCTA
GCTATGGGGTTCCTAGGCCCTGAAGCGACTATTGCTGAGAAACTAGGTTTGGAGAAAGAC
AACCGGTCTAACTTCAAAGCTCAATTTGGAAACTTTGCAACCAGTGTGGATGGCATTTTT
GCTGCCGGGGACTGCAGACGTGGACAATCACTTGTTGTTTGGGCCATCACCGAGGGGCGG
CAAGCTGCTGCAGCTGTCGACAAGTACTTGTCAAGGAATGAACAAGATGCCGCAGAGGAC
ATAACCCCCTCGGGTGCAGGTTTTGTGCAGCCTGTTGCAGCATAAATGAAACAGGCAAAC
TTTTCAAGACCAGTGCAATCTAAATTAGGATCAACGTTTTTAGTCTTTGATCACAGCAAG
TTGTCTTTGAAAGATAAGGCCGGGCTCAATAGGGAAAAGAGAAGAGCCTTCTTATATTTT
GGTAGATAAACAATTGGAAATTTTGGTGTGTTCTGCTTGTTACTTTTCCAGTAAAATGAT
TTGCATGGTGAAATGCCGTTTTGTAATCTGAATAATAATGTACAGTTGTTTTGGTTTAAT
TAATAGATGTAAATTTGTCT

CDS

6504 bp

>Os01t0681900-01 Glutamate synthetase, Primary ammonium ions assimilation in seedling roots, Development of tillers, Tolerance to nitrogen-limitation
ATGTCGGCGGCGCAAGGGATGGCCTACAAGCTCCGCACCGACGCGGCGCCCACGGGCGCT
GGCCGCAGGGCTCGGCGCAGCCACTCCTCCGTGGCGGCGCCTTACCGCGCGGCTAGGCTG
GTACAGGGCGGCGTGTCCATCGAGGGCGGTTTGGTCGGCGGATGCCAGCTCACCGAGGAG
CGCGTCGCCGCACGGCCGCCCCGCGCCGCCGCGCGCGACGCCGAGCCGGTCAGGCCACTT
TCGACGCTCCCCGAGAGCAGCATTGGGCTGTACGACCCCTCGCGCGAGCGCGACTCGTGC
GGCGTTGGTTTCGTCGCCGAGCTGTCGGGCGATTACAAGCGCGCGACGGTCAATGACGCC
CTCGAGATGCTTGAGAGAATGGCGCACCGTGGTGCCTGCGGCTGTGAGAAGAACACTGGC
GATGGTGCCGGCATCCTTGTGGCTCTACCGCATAACTTTTTCAGAGAGGTGACAAAGGAT
GCTGGGTTTGAGCTACCGCAGCCAGGCGAGTATGCTGTCGGTATGGTCTTCCTGCCAATC
GATGAGAAGCGCCGTGAGCGGAGCAAAGCTGAGTTTCAGAAGGTAGCGGAATCGCTGGGA
CATGTAATACTTGGGTGGCGCCGGGTTCCCACTGACAACTCAGACTTAGGTGAATCTGCG
CTCCAGACTGAGCCAGTTATTGAGCAGGTTTTCCTCACCAAAAGTTCAAGTTCGGAGGCT
GATTTTGAGCAGCAGTTGTATATCCTGAGGAGGCTCTCGATTCTATCTATCCGTGCAGCT
CTGAATCTCCGTCGTGGAGGAAAGAGGGACTTCTACATGTGTTCTCTCTCCTCAAGGACT
ATTGTCTACAAGGGCCAGCTTAAGCCATGCCAACTTAAGGGGTACTACTATGCAGATCTA
GGTCATGAAAACTTCACAAGTTATATGGCTCTGGTTCACTCAAGGTTCTCCACGAACACC
TTCCCCAGCTGGGACCGTGCACAGCCGATGCGTGTATTAGGTCATAATGGAGAGATCAAT
ACCCTCAAAGGGAACAAGAATTGGATGAAAGCACGAGAAGGTCTCTTAGAGTGTGAGAAG
CTTGGCCTAACAAAGGATCAGTTTTCAAAAATTCTACCAATTGTGGATGCTACCTCGTCT
GATTCAGGTGCTTTCGATGGTGTTCTTGAACTTCTTATCCGTGGTGGAAGAAGCCTGCCA
GAAGCTGTGATGATGATGATACCTGAGGCATGGCAGAACGATGTGAACATGGAACCTGAG
AAGAAAGCTCTCTATGAGTTCTTGTCTGCCCTTATGGAGCCTTGGGATGGACCTGCTCTA
ATATCTTTTACTGATGGCCGTTACCTTGGAGCCACCCTGGATCGCAATGGGTTGAGGCCT
GGTCGATTTTATGTGACACACAGTGGACGTGTAGTCATGGGAAGTGAAGTTGGTGTTGTT
GATGTTCCTTCCAAAGATGTATTGAGAAAGGGTAGACTAAACCCTGGAATGATGCTGTTG
GTTGATTTTGAGAACCATACTGTAGTGGATGATGAAGCATTGAAGGCACAGTACTCGAAA
GCTCACCCATATGGGGAGTGGCTCAAGAGACAAAAAATATACCTCAAAGACATTGTAGAA
TCTGTGCCAGAAACTGAGAGAGTTGCTCCTGGAATTTCTGGTTCACTCACACAAAAGAAT
GAGAAAAAGGAACATGCAGGCGTCAATGGGATTGTGACTCCACTAAAAGCCTTTGGATAC
ACAGTTGAAGCCCTTGAAATGCTGCTTCTCCCGATGGCTAAAGATGGAGTTGAAGCTCTT
GGATCCATGGGAAATGACACACCCTTGGCAGTCATGTCAAACAGAGAGAAGTTGACTTTT
GAGTACTTCAAACAGATGTTTGCACAAGTTACAAACCCGCCAATCGACCCAATTAGGGAG
AAAATTGTTACATCTATGGAGTGTATGATTGGGCCAGAAGGTGACTTGTTGGAAACAACT
GAAAAGCAATGCAACCGCCTTGCACTTGAGGGTCCTTTGGTGTCGATTGATGAAATGGAG
GCTATTAAGAAGATGAACTACCGTGGTTGGCGAAGCAAGGTGCTCGACATAACTTATCCA
AAGAAGTCTGGAAGGAAGGGCTTGGAAGAAACTTTGGACAGAATTTGCACAGAAGCTCGG
GGAGCTATAAAGAAGGGCTACACTGTTTTAGTTCTCTCAGATAGAGGATTTTCCTCAGAC
CGTGTTGCTGTCAGTTCGCTCTTAGCAGTTGGCGCGGTACATCAGCATCTTGTGGCCAAT
CTTGAGAGGACGCGCGTAGGTTTGTTGGTGGAGTCTGCTGAACCTCGTGAAGTGCACCAC
TTCTGCACCCTTGTTGGGTTTGGTGCTGATGCTGTATGCCCTTATTTGGCTATCGAAGCA
ATTTGGTGCTTGCAGAATGATGGGAAGATTCCTCCTAATGGTGATGGGAAACCCTACTCA
AAGGAAGAACTTGTCAAGAAATATTTCTATGCTTCTAACTATGGAATGATGAAAGTTCTT
GCAAAGATGGGAATTTCCACCCTTGCATCTTACAAAGGTGCACAGATTTTTGAAGCTCTT
GGCCTTTCCTCTGAAGTCATCCGTAAGTGTTTTGATGGTACACCTAGCCGAATTGAAGGC
GCCACTTTTGAAATGCTTGCACGAGATGCTCTACGTCTTCATGAGTTGGCATTTCCATCA
AGAGCACCTCCACCAGGAAGTGCAGATGCAAAGGCCCTTCCCAATCCAGGGGACTACCAC
TGGAGGAAAAATGGTGAAGTCCACCTCAATGATCCCCTTGCAATGGCAAAACTACAAGAA
GCTGCTAGAGTAAACAGCCGGGCAGCATACAAAGAATATTCTAGGCGTATTCAGGAGCTC
AACAAAACCTGCAACCTGCGTGGTATGCTTAAATTTAAAGACACTGCTGACATGATTTCT
GTGGACGAGGTTGAACCTGCAAGTGAGATCGTTAAACGCTTTGTTACTGGTGCAATGAGT
TATGGATCCATTTCTTTGGAAGCACATACTGCCCTTGCTATGGCCATGAACAAACTTGGA
GGGAAATCTAATACAGGTGAGGGAGGGGAACAGCCTTCTCGTATGGAACCACTTGCTAAT
GGTTCAATGAATCCAAAAAGAAGTGCAATCAAGCAAGTTGCCAGTGGAAGATTTGGAGTT
TCAAGCTATTATCTGACTAACGCTGATGAACTGCAGATAAAAATGGCTCAGGGTGCTAAG
CCTGGTGAAGGTGGTGAGCTTCCAGGCCACAAGGTTATTGGTGACATTGCGGTTACAAGA
CACTCTACTGCTGGTGTAGGACTGATTAGCCCACCTCCTCACCATGACATATATTCTATT
GAGGATCTTGCACAACTTATCCACGACCTTAAGAATTCAAATCCTAGAGCTCGCATAAGC
GTCAAGCTAGTTTCTGAGGCTGGTGTAGGAGTTGTTGCTAGTGGTGTTGTAAAAGGACAT
GCAGACCATGTCCTTATATCTGGCCATGATGGAGGGACGGGAGCTTCTAGGTGGACAGGT
ATTAAAAATGCTGGCCTTCCATGGGAACTTGGATTGGCTGAGACACATCAAACTCTAGTG
GCAAATGGGCTTCGTGGCCGAGCTATTCTGCAAACTGACGGGCAGTTAAAAACTGGCAAA
GATGTAGCTGTTGCTTGCTTACTTGGCGCAGAAGAATTTGGTTTCAGTACTGCTCCGTTG
ATCACACTTGGTTGCATCATGATGCGGAAATGTCATACCAACACTTGCCCTGTTGGTATA
GCTACTCAAGATCCAGTGCTACGAGAAAAGTTTGCTGGAGAACCAGAGCATGTTATCAAC
TTCTTCTTCATGCTTGCTGAGGAGCTAAGAGAAATCATGTCTCAGCTTGGCTTCCGTACC
ATTACTGAAATGGTTGGGCGCTCTGACATGCTTGAGGTTGATCCAGAAGTAGTGAAGAGC
AACGAGAAACTTGAGAACATTGATCTCTCATTGATTTTGAAACCAGCTGCAGAGATTCGC
CCTGGGGCTGCTCAGTACTGTGTTGAAAAGCAAGATCATGGTCTTGACATGGCATTAGAT
AACAAACTCATAGCTTTATCAAAAGCTGCACTTGAGAAGGAAGTTCGTGTTTTCATTGAG
ACTCCAATCCAGAATACTAACCGAGCAGTAGGCACTATGCTTAGTCATGAAGTCACAAAG
CGTTATCACATGAAGGGATTACCTGCAGGTACGATTCATGTGAAGCTCACTGGAAGTGCT
GGTCAAAGTCTTGGCGCTTTTCTCTGTCCTGGAATCACCCTTGAGCTTGAAGGAGACAGC
AATGATTATGTTGGCAAAGGATTGTCTGGCGGAAAAATTGTTGTCTACCCACCAAGAGAT
AGTACATTTATTCCAGAAGACAATATTGTAATTGGTAATGTGGCTCTATATGGTGCTACT
ATAGGAGAGGCATATTTCAATGGAATGGCTGCAGAAAGGTTTTGCGTGCGCAATTCAGGT
GCTCAAGCTGTGGTTGAAGGAATTGGTGATCATGGGTGTGAGTACATGACAGGGGGTACT
GTGGTTATCCTTGGTAAAACAGGAAGAAACTTTGCTGCTGGGATGAGTGGAGGCATTGCT
TATGTTTATGATATTGATGGGAAATTCAGCGTCCGCTGTAACCATGAGTTAGTTGATCTC
TATCATGTGGAGGAAGAGGAAGACATTACCACATTGAAAATGATGATAGAACAACATCGA
CTTAACACTGGGAGTGTTGTTGCTAGAGATATACTCTCTAATTTTGATACTCTTCTTCCA
AAATTTGTCAAGGTATTCCCAAGAGATTATAAGAGGGTTTTGGACAATATGAAGGCTGAA
AAGGCTGCTGCTAAGCTTGCAAAGGAACCAAAGATTTCAAATGGTGTTTCTGTAACCACT
AAGAAAGTGCAACCGGAGCAATCAACAAACCGACCAACACGTGTTTCCAATGCCAAAAAG
TACCGAGGTTTCATTTCATATGAGCGAGAGAGTATTTCTTACCGGGATCCAAATGAGCGT
GTAAAAGATTGGAAGGAAGTTGCAATTGAATCAGTGCCAGGGCCACTACTGAACACACAG
TCTGCTCGTTGTATGGATTGTGGAACTCCTTTCTGTCATCAGGAAAGCTCAGGTGCTGGC
TGTCCTCTTGGAAATAAGATTCCAGAGTTCAATGAACTGGTTCACCAGAACAGATGGCGT
GAAGCACTAGATCGTCTGCTTGAGACGAACAACTTCCCTGAATTTACTGGAAGAGTATGC
CCTGCTCCCTGTGAGGGATCATGTGTTCTTGGCATTATTGAAAATCCAGTATCTATCAAA
AGCATAGAATGTGCGATCATAGACAAAGGTTTTGAAGAGGGATGGATGGTACCGCGGCCT
CCACTTCAAAGAACAGGAAAGAAGGTTGCCATCATTGGAAGTGGTCCGGCTGGTTTGGCT
GCTGCAGATCAACTAAACAAAATGGGCCATTTTGTTACTGTGTTTGAACGTGCTGATCGT
ATTGGTGGTCTGATGATGTATGGAGTGCCAAACATGAAGACAGACAAGATTGAAATTGTG
CAACGCCGTGTCAATTTAATGGCAGAAGAGGGCATTACATTTGTAGTGAACGCTAATGTA
GGCAGTGATCCTTTGTATTCAATTGAGCGCCTCCGTTCTGAGAATGATGCAGTCATTTTG
GCTTGTGGAGCTACTAAACCAAGGGATCTAGGTATTCCTGGACGCGAGTTATCAGGAGTT
CATTTTGCCATGGAGTTCCTCCATGCAAATACGAAAAGTTTACTTGACAGCAACTTGGAG
GATGGTAGATACATATCTGCCAAGGGGAAAAAGGTTGTGGTTATTGGTGGTGGTGACACA
GGCACAGATTGCATTGGTACATCTATTCGGCATGGTTGCACCAGCATTGTAAACCTTGAA
CTTCTTACCAAACCACCAAGCAAGAGAGCAGCTGATAACCCATGGCCACAGTGGCCTAGA
ATCTTCCGTGTTGACTATGGGCACCAGGAAGCATCTAGTAAGTTTGGAAATGACCCAAGA
ACTTACGAAGTCCTGACCAAGCGTTTTATTGGTGATGAAAATGGAAACGTGAAGGCCCTT
GAGGTGGTCCGGGTCAAGTGGGAGAAAGTCGATGGGAGATTCCAGTTCAAAGAAATTGAA
GGCTCAAACGAGACCATTGAGGCTGATCTTGTCCTCCTAGCTATGGGGTTCCTAGGCCCT
GAAGCGACTATTGCTGAGAAACTAGGTTTGGAGAAAGACAACCGGTCTAACTTCAAAGCT
CAATTTGGAAACTTTGCAACCAGTGTGGATGGCATTTTTGCTGCCGGGGACTGCAGACGT
GGACAATCACTTGTTGTTTGGGCCATCACCGAGGGGCGGCAAGCTGCTGCAGCTGTCGAC
AAGTACTTGTCAAGGAATGAACAAGATGCCGCAGAGGACATAACCCCCTCGGGTGCAGGT
TTTGTGCAGCCTGTTGCAGCATAA

Protein

2167 aa

>Os01t0681900-01 Glutamate synthetase, Primary ammonium ions assimilation in seedling roots, Development of tillers, Tolerance to nitrogen-limitation
MSAAQGMAYKLRTDAAPTGAGRRARRSHSSVAAPYRAARLVQGGVSIEGGLVGGCQLTEE
RVAARPPRAAARDAEPVRPLSTLPESSIGLYDPSRERDSCGVGFVAELSGDYKRATVNDA
LEMLERMAHRGACGCEKNTGDGAGILVALPHNFFREVTKDAGFELPQPGEYAVGMVFLPI
DEKRRERSKAEFQKVAESLGHVILGWRRVPTDNSDLGESALQTEPVIEQVFLTKSSSSEA
DFEQQLYILRRLSILSIRAALNLRRGGKRDFYMCSLSSRTIVYKGQLKPCQLKGYYYADL
GHENFTSYMALVHSRFSTNTFPSWDRAQPMRVLGHNGEINTLKGNKNWMKAREGLLECEK
LGLTKDQFSKILPIVDATSSDSGAFDGVLELLIRGGRSLPEAVMMMIPEAWQNDVNMEPE
KKALYEFLSALMEPWDGPALISFTDGRYLGATLDRNGLRPGRFYVTHSGRVVMGSEVGVV
DVPSKDVLRKGRLNPGMMLLVDFENHTVVDDEALKAQYSKAHPYGEWLKRQKIYLKDIVE
SVPETERVAPGISGSLTQKNEKKEHAGVNGIVTPLKAFGYTVEALEMLLLPMAKDGVEAL
GSMGNDTPLAVMSNREKLTFEYFKQMFAQVTNPPIDPIREKIVTSMECMIGPEGDLLETT
EKQCNRLALEGPLVSIDEMEAIKKMNYRGWRSKVLDITYPKKSGRKGLEETLDRICTEAR
GAIKKGYTVLVLSDRGFSSDRVAVSSLLAVGAVHQHLVANLERTRVGLLVESAEPREVHH
FCTLVGFGADAVCPYLAIEAIWCLQNDGKIPPNGDGKPYSKEELVKKYFYASNYGMMKVL
AKMGISTLASYKGAQIFEALGLSSEVIRKCFDGTPSRIEGATFEMLARDALRLHELAFPS
RAPPPGSADAKALPNPGDYHWRKNGEVHLNDPLAMAKLQEAARVNSRAAYKEYSRRIQEL
NKTCNLRGMLKFKDTADMISVDEVEPASEIVKRFVTGAMSYGSISLEAHTALAMAMNKLG
GKSNTGEGGEQPSRMEPLANGSMNPKRSAIKQVASGRFGVSSYYLTNADELQIKMAQGAK
PGEGGELPGHKVIGDIAVTRHSTAGVGLISPPPHHDIYSIEDLAQLIHDLKNSNPRARIS
VKLVSEAGVGVVASGVVKGHADHVLISGHDGGTGASRWTGIKNAGLPWELGLAETHQTLV
ANGLRGRAILQTDGQLKTGKDVAVACLLGAEEFGFSTAPLITLGCIMMRKCHTNTCPVGI
ATQDPVLREKFAGEPEHVINFFFMLAEELREIMSQLGFRTITEMVGRSDMLEVDPEVVKS
NEKLENIDLSLILKPAAEIRPGAAQYCVEKQDHGLDMALDNKLIALSKAALEKEVRVFIE
TPIQNTNRAVGTMLSHEVTKRYHMKGLPAGTIHVKLTGSAGQSLGAFLCPGITLELEGDS
NDYVGKGLSGGKIVVYPPRDSTFIPEDNIVIGNVALYGATIGEAYFNGMAAERFCVRNSG
AQAVVEGIGDHGCEYMTGGTVVILGKTGRNFAAGMSGGIAYVYDIDGKFSVRCNHELVDL
YHVEEEEDITTLKMMIEQHRLNTGSVVARDILSNFDTLLPKFVKVFPRDYKRVLDNMKAE
KAAAKLAKEPKISNGVSVTTKKVQPEQSTNRPTRVSNAKKYRGFISYERESISYRDPNER
VKDWKEVAIESVPGPLLNTQSARCMDCGTPFCHQESSGAGCPLGNKIPEFNELVHQNRWR
EALDRLLETNNFPEFTGRVCPAPCEGSCVLGIIENPVSIKSIECAIIDKGFEEGWMVPRP
PLQRTGKKVAIIGSGPAGLAAADQLNKMGHFVTVFERADRIGGLMMYGVPNMKTDKIEIV
QRRVNLMAEEGITFVVNANVGSDPLYSIERLRSENDAVILACGATKPRDLGIPGRELSGV
HFAMEFLHANTKSLLDSNLEDGRYISAKGKKVVVIGGGDTGTDCIGTSIRHGCTSIVNLE
LLTKPPSKRAADNPWPQWPRIFRVDYGHQEASSKFGNDPRTYEVLTKRFIGDENGNVKAL
EVVRVKWEKVDGRFQFKEIEGSNETIEADLVLLAMGFLGPEATIAEKLGLEKDNRSNFKA
QFGNFATSVDGIFAAGDCRRGQSLVVWAITEGRQAAAAVDKYLSRNEQDAAEDITPSGAG
FVQPVAA*

5'UTR

chr01:28102684..28102914 (- strand) : 231 bp

chr01:28102050..28102079 (- strand) : 30 bp

CDS

chr01:28101702..28102049 (- strand) : 348 bp

chr01:28101507..28101626 (- strand) : 120 bp

chr01:28101303..28101416 (- strand) : 114 bp

chr01:28101066..28101218 (- strand) : 153 bp

chr01:28100880..28100980 (- strand) : 101 bp

chr01:28100390..28100486 (- strand) : 97 bp

chr01:28099795..28099904 (- strand) : 110 bp

chr01:28099559..28099662 (- strand) : 104 bp

chr01:28099273..28099452 (- strand) : 180 bp

chr01:28098847..28099190 (- strand) : 344 bp

chr01:28098659..28098723 (- strand) : 65 bp

chr01:28098105..28098574 (- strand) : 470 bp

chr01:28096937..28097806 (- strand) : 870 bp

chr01:28096254..28096408 (- strand) : 155 bp

chr01:28095978..28096139 (- strand) : 162 bp

chr01:28094228..28095757 (- strand) : 1530 bp

chr01:28093776..28093994 (- strand) : 219 bp

chr01:28093111..28093385 (- strand) : 275 bp

chr01:28092690..28092995 (- strand) : 306 bp

chr01:28092273..28092540 (- strand) : 268 bp

chr01:28091845..28092099 (- strand) : 255 bp

chr01:28091488..28091745 (- strand) : 258 bp

3'UTR

chr01:28091213..28091487 (- strand) : 275 bp

FASTA

>Os01t0681900-01 class=Sequence position=chr01:28091213..28102914 (- strand)
CGGGAAGAGA CCCGCGAGAG AGGCGGCGCC CCGTTTCGTC CCCAAAACCG ATCCATTCAT TCGccaacca cgccgtccgc
cgcgtcgccg gtagagaagg ccgccgtgcg tgcgggagag aagggggaag cacaaaccgc gctcggggac gagagccgcg
aggcgaaggt gtggggagga tcgggacgcg gcgtcggcGT CGGTCTCACC TCCGGGCTAC AAGAGCGAGA GGTACCCGCT
CGGCCGCACG CACCCTTCCT CATCGTCGTC CTCCCAACTT GACAGGATCG GGAGACGGTT TTCCAAAAAA GAAAAAAAAA
ACAAGTTGCT CGGCTTTTGG GGTTCGGTTT GGCTTTGTTT GGTTGGGTTG TGCGTTGTGG TTGGTGGTGG TGGTGGTGGC
CGCCGGCGTC GAGAGCTCTC CGCCTATCGG CCTATGTATT TTTTTTATGT TTCGATCTAC TGGTGGCTCG CTCGATTCTG
CGTTCGTGCG TGCCGGTCGT GTGGGGGCGG ATGGAATCTG CGTCGCCGTG TGGGGGTTGG TAGATCTGTT CATCCCCCGC
GTGTGTCGCC GTTTGCCCTG TGTGCGTGTA TTTTTCTCGT TTTGCAAATT GCAAGTGCTG TGCTGTGTTC CATCGCAGCA
TGACACGAGT TCCCTCCCGT TGCTTTTGGT GGTGACATGT GGGAAAGGGA GATTGCTTTG AGGATTTTCT GTTCGTTTGT
CTACTTTTTT TTTTCTCTTC CCTGCTCTGT ATTTTTGTGA TGGGATTTTG TTCGTTTTCT TCTTCCTGGT GGTAGAAGTA
CGGTCTAATG CTCGTCGTTT GATGCCGCGT GACAGGTAGC AGAGGGAGAG TCGTGAGGTG CAGCCATGTC GGCGGCGCAA
GGGATGGCCT ACAAGCTCCG CACCGACGCG GCGCCCACGG GCGCTGGCCG CAGGGCTCGG CGCAGCCACT CCTCCGTGGC
GGCGCCTTAC CGCGCGGCTA GGCTGGTACA GGGCGGCGTG TCCATCGAGG GCGGTTTGGT CGGCGGATGC CAGCTCACCG
AGGAGCGCGT CGCCGCACGG CCGCCCCGCG CCGCCGCGCG CGACGCCGAG CCGGTCAGGC CACTTTCGAC GCTCCCCGAG
AGCAGCATTG GGCTGTACGA CCCCTCGCGC GAGCGCGACT CGTGCGGCGT TGGTTTCGTC GCCGAGCTGT CGGGCGATTA
CAAGCGCGCG ACGGTAGGTG GTAGCTCTGC AGGTTCTCTC TTCTGAACAT CACCTTTGCG ATATCGATCT GATTTCACTT
CTCTGCAGGT CAATGACGCC CTCGAGATGC TTGAGAGAAT GGCGCACCGT GGTGCCTGCG GCTGTGAGAA GAACACTGGC
GATGGTGCCG GCATCCTTGT GGCTCTACCG CATAACTTTT TCAGAGAGGC GAGCTAGAAA CTCAATAAAA TTTTAAGGCA
AAGGCAGCTC GTTTTAACAG TTAATTCATC TTAGCTGTTA CCGTTTGTAC TCCTGCAGGT GACAAAGGAT GCTGGGTTTG
AGCTACCGCA GCCAGGCGAG TATGCTGTCG GTATGGTCTT CCTGCCAATC GATGAGAAGC GCCGTGAGCG GAGCAAAGCT
GAGTTTCAGA AGGTTAGTTG TTTTCATTTC TTTTGTTTTT TCAATTCATG GCCGTGATAT TTACACTAAT GTTTTCTGTT
ACTTTCATTT ATCCAGGTAG CGGAATCGCT GGGACATGTA ATACTTGGGT GGCGCCGGGT TCCCACTGAC AACTCAGACT
TAGGTGAATC TGCGCTCCAG ACTGAGCCAG TTATTGAGCA GGTTTTCCTC ACCAAAAGTT CAAGTTCGGA GGCTGATTTT
GAGCAGCAGG TCATTCCACG AGTTTACATT TTGAATTTAT GAATGCGTAT GTAGTAGACT GTGTATTTAA CTCATTTGTA
ATGAATTATT ACAGTTGTAT ATCCTGAGGA GGCTCTCGAT TCTATCTATC CGTGCAGCTC TGAATCTCCG TCGTGGAGGA
AAGAGGGACT TCTACATGTG TTCTCTCTCC TCAAGGTACT TCTTCCTCTT TTCTCTCTTC TTCCATATTT CAAGTTCTCT
ATGTTTGATT GAGTTGAAGG ATGGAAAGGA TGATGATTCC CAAATCCCAA TCAAGTACAC ATTTCATTTT TTGGAAGAGA
TCATCAGCAA ATATTTTCCA AATTTCATGT TTCCTGTGTT TGATTACGTT GAAGGATGAA AGCGATGATG ATACCCAAAT
CCCAATCAAG TTCACATTTC TTTTTTTTTT TTGGGGGGGG GGATCATCAG CAAATATTTT CTATTTCAAA TGGGACTAAA
GAAAGAAAAA ACAATGAGCT CTCTCTTAAG GATCCTGTAG TGTAATAACT TTCTAATTGT GTTCTATTCA TGTGAGTAAT
TCAATGTTTG CTTTCTTGTG ATTTCCAGGA CTATTGTCTA CAAGGGCCAG CTTAAGCCAT GCCAACTTAA GGGGTACTAC
TATGCAGATC TAGGTCATGA AAACTTCACA AGTTATATGG CTCTGGTAAA TACAATACCT TGATCCTCTT ATACAAAAAA
AGTCATGACC ATAGTCGGCG GATGGGAACC AATAATAGCA AGGCAGTTGT AAGATCAAGA CTCCTGTGCA GGCATCAAAC
TTTGAATTGT CTTACCATCA CTGCTCTATT CATATGATAT TTCAGTCCTG GTTCTTGATG CCTTTAAGTG AAGTATTAGA
AATCTTTATT AGTTGATACT CGATAACCAT GTTGCAGAGT CCAGCTGCAG TTCTGCTATG GCCGACTGCT ATGCCGACTC
TTCTGGATGT GACCTCCAAT TAGGTGGTGG GAAGAAATTG TGTTTGGTTT GAGGTAGCTT AGGGCTTCCA ACTGTTTTGC
ATGAAATTCT ATGCAACTGA TGCTTCAGTT TTTTCAGTGT GTTGGTGTTT CATTTAGAAG TTTTGTTCAA CATTGTAAAA
TTACAAGAGT TGAGTATAAT ACAGTTACTA AGTTTCATGC ATCCAAACAG GTTCACTCAA GGTTCTCCAC GAACACCTTC
CCCAGCTGGG ACCGTGCACA GCCGATGCGT GTATTAGGTC ATAATGGAGA GATCAATACC CTCAAAGGGA ACAAGAATTG
GTAATCTTGC TTTTTTTTTT TGGAATGCTC CATACAATGT CCATTTCTAG GTTGTATGTA ATCATCTCCA CATGGCTATG
CCATTTTTGT TTATGATTCT TGGTTTTATA ACTGCTTTTG CATGCATGGC AGGATGAAAG CACGAGAAGG TCTCTTAGAG
TGTGAGAAGC TTGGCCTAAC AAAGGATCAG TTTTCAAAAA TTCTACCAAT TGTGGATGCT ACCTCGTCTG ATTCAGGTAA
GAGCTAATTG TTTCATGCAG TGAAACATCA AGTACACTTA GAAAATGGGA TTTTCCTTAT TTTTAGAGAT TTGTTAATTA
GATAGAATCA TTTCAATTCT AGGTGCTTTC GATGGTGTTC TTGAACTTCT TATCCGTGGT GGAAGAAGCC TGCCAGAAGC
TGTGATGATG ATGATACCTG AGGCATGGCA GAACGATGTG AACATGGAAC CTGAGAAGAA AGCTCTCTAT GAGTTCTTGT
CTGCCCTTAT GGAGCCTTGG GATGGACCTG CTCTAATATC TTGTAAGAAG ATACGGAAGA CCTTTTCCTT CCTGATCACA
CATTTCCCAT GTACTATTTG TGGTTACTTT GCTTTCATCT GCAGTTACTG ATGGCCGTTA CCTTGGAGCC ACCCTGGATC
GCAATGGGTT GAGGCCTGGT CGATTTTATG TGACACACAG TGGACGTGTA GTCATGGGAA GTGAAGTTGG TGTTGTTGAT
GTTCCTTCCA AAGATGTATT GAGAAAGGGT AGACTAAACC CTGGAATGAT GCTGTTGGTT GATTTTGAGA ACCATACTGT
AGTGGATGAT GAAGCATTGA AGGCACAGTA CTCGAAAGCT CACCCATATG GGGAGTGGCT CAAGAGACAA AAAATATACC
TCAAAGACAT TGTAGAATCT GTGCCAGAAA CTGAGAGAGT TGCTCCTGGA ATTTCTGGTT CACTCACAGT AAGTCTGTTA
CAGTGTTTTA ACATTTTATT TTATTTTTTC ACTGGCTACA ATTTTAGCTG GTATTTATGA GAATTTGGTT ACACTATAAT
TACTTATCTT TTTTTTTACA CTTTGGTGTA GCAAAAGAAT GAGAAAAAGG AACATGCAGG CGTCAATGGG ATTGTGACTC
CACTAAAAGC CTTTGGGTAA GCAAGGTTTC GACTTTGTTG ACTATCTTTG CTGTTTTGAG TTCCTTTTTG GTTTATTTAT
CAAATTTATT TTTACTGCAG ATACACAGTT GAAGCCCTTG AAATGCTGCT TCTCCCGATG GCTAAAGATG GAGTTGAAGC
TCTTGGATCC ATGGGAAATG ACACACCCTT GGCAGTCATG TCAAACAGAG AGAAGTTGAC TTTTGAGTAC TTCAAACAGA
TGTTTGCACA AGTTACAAAC CCGCCAATCG ACCCAATTAG GGAGAAAATT GTTACATCTA TGGAGTGTAT GATTGGGCCA
GAAGGTGACT TGTTGGAAAC AACTGAAAAG CAATGCAACC GCCTTGCACT TGAGGGTCCT TTGGTGTCGA TTGATGAAAT
GGAGGCTATT AAGAAGATGA ACTACCGTGG TTGGCGAAGC AAGGTGCTCG ACATAACTTA TCCAAAGAAG TCTGGAAGGA
AGGGCTTGGA AGAAACTTTG GACAGAATTT GCACAGAAGC TCGGGGAGCT ATAAAGAAGG GCTACACTGT TTTAGTTCTC
TCAGATAGAG GTCAGTGAAA TATTCAATAT ATACTACTGA TGTTTCATTA CTCATTACTC ATAATTTTGT AATCATTCCT
GCGGTAGTCA AACGCATTCA ACAAATTTAT TTTTATTTAA ATGTAGCTCC AAGCATATAA TTTTGGAATA TAATAGGTCG
AATATTATCA ATTAAGTAGG TGTAGCGCTG TTATTATCAA CAAAGTTATA ACATTCGTTT ACCTTATGCA TTTCCGTGTC
TACGACATTC TTCAACATTT GACCTTTCTC GCATGAAACT TACTGTTTTG TTTAAATTCT TGATGCAGGA TTTTCCTCAG
ACCGTGTTGC TGTCAGTTCG CTCTTAGCAG TTGGCGCGGT ACATCAGCAT CTTGTGGCCA ATCTTGAGAG GACGCGCGTA
GGTTTGTTGG TGGAGTCTGC TGAACCTCGT GAAGTGCACC ACTTCTGCAC CCTTGTTGGG TTTGGTGCTG ATGCTGTATG
CCCTTATTTG GCTATCGAAG CAATTTGGTG CTTGCAGAAT GATGGGAAGA TTCCTCCTAA TGGTGATGGG AAACCCTACT
CAAAGGAAGA ACTTGTCAAG AAATATTTCT ATGCTTCTAA CTATGGAATG ATGAAAGTTC TTGCAAAGAT GGGAATTTCC
ACCCTTGCAT CTTACAAAGG TGCACAGATT TTTGAAGCTC TTGGCCTTTC CTCTGAAGTC ATCCGTAAGT GTTTTGATGG
TACACCTAGC CGAATTGAAG GCGCCACTTT TGAAATGCTT GCACGAGATG CTCTACGTCT TCATGAGTTG GCATTTCCAT
CAAGAGCACC TCCACCAGGA AGTGCAGATG CAAAGGCCCT TCCCAATCCA GGGGACTACC ACTGGAGGAA AAATGGTGAA
GTCCACCTCA ATGATCCCCT TGCAATGGCA AAACTACAAG AAGCTGCTAG AGTAAACAGC CGGGCAGCAT ACAAAGAATA
TTCTAGGCGT ATTCAGGAGC TCAACAAAAC CTGCAACCTG CGTGGTATGC TTAAATTTAA AGACACTGCT GACATGATTT
CTGTGGACGA GGTTGAACCT GCAAGTGAGA TCGTTAAACG CTTTGTTACT GGTGCAATGA GTTATGGATC CATTTCTTTG
GAAGCACATA CTGCCCTTGC TATGGCCATG AACAAACTTG GAGGGAAATC TAATACAGGT ACACTGAAAT ACTATGTAGC
ATTTGTCCCT TTGTTGCTAC CATTTGCACA ATCTGCAGTA AGAACACTTT ATGGAATTAC CTTTCAAAAC AAGCCTTCTG
TTCTGAGCCA CTATTTTAGA CATACTTGTA CCTACAAATG AACTTATTTT GATTCTATCA AACAAAAAGG TATTTACTGC
ATTTCACTCA AAGAAACTTA TACGGTACCT TGCTATTTTT TTTAAAAAAT CTTCTGTTGG TGTGGAGAGT GCCTTCTGAA
GACAAAATAT CACTATTTTT AGTGGGATTG AGTTTTTTCC TTGCTATACA GAAAATTCTT TCCTGCAAGA AGCATATTGC
ACTATTTGAG ACTTTATTTT TTGTGTTTTA TTTTATTTAA CTGTTTCTTT CTTGTTTAAC ATATTTCTAG AACTTAATAT
TACTTTTATT CCCAGGTCTA AAATATCTCC TTTTACCCTT TTGCTATTTT GAGTAGAATC CATAACCTCT AAACCATTAT
GCACTAACTC TAATACATCT GTGAAGGTGA GGGAGGGGAA CAGCCTTCTC GTATGGAACC ACTTGCTAAT GGTTCAATGA
ATCCAAAAAG AAGTGCAATC AAGCAAGTTG CCAGTGGAAG ATTTGGAGTT TCAAGCTATT ATCTGACTAA CGCTGATGAA
CTGCAGATAA AAATGGCTCA GGTACTTGTC AACATTGTGC ACTACAAAAT CATTAAAATG ATTGCAGCAG TCTATTGAAA
GCACCTACCA TGTTGCAGAA ATTTACCTTT TGTTATAACT TCTTTATGTA TGTAGGGTGC TAAGCCTGGT GAAGGTGGTG
AGCTTCCAGG CCACAAGGTT ATTGGTGACA TTGCGGTTAC AAGACACTCT ACTGCTGGTG TAGGACTGAT TAGCCCACCT
CCTCACCATG ACATATATTC TATTGAGGAT CTTGCACAAC TTATCCACGA CCTTAAGGTA ACTTAATGTG ATACTGCATT
GCTATTTCTT GAAACCAAGC GATTTGTTGT TATTTTTGTA TAGTTGTTAG TACTAGATTT ATTTCTGAGA TATCATACCA
ACTCATGATC GCTCATTTGC CATGCAACAT TTTACAATTG AACTTGAACA CATGCATGCA ATTTGCAAAT GTTGCTTCCT
GATATATGGT GACATTCTTG TTGCTTGTAC TCTTCAGAAT TCAAATCCTA GAGCTCGCAT AAGCGTCAAG CTAGTTTCTG
AGGCTGGTGT AGGAGTTGTT GCTAGTGGTG TTGTAAAAGG ACATGCAGAC CATGTCCTTA TATCTGGCCA TGATGGAGGG
ACGGGAGCTT CTAGGTGGAC AGGTATTAAA AATGCTGGCC TTCCATGGGA ACTTGGATTG GCTGAGACAC ATCAAACTCT
AGTGGCAAAT GGGCTTCGTG GCCGAGCTAT TCTGCAAACT GACGGGCAGT TAAAAACTGG CAAAGATGTA GCTGTTGCTT
GCTTACTTGG CGCAGAAGAA TTTGGTTTCA GTACTGCTCC GTTGATCACA CTTGGTTGCA TCATGATGCG GAAATGTCAT
ACCAACACTT GCCCTGTTGG TATAGCTACT CAAGATCCAG TGCTACGAGA AAAGTTTGCT GGAGAACCAG AGCATGTTAT
CAACTTCTTC TTCATGCTTG CTGAGGAGCT AAGAGAAATC ATGTCTCAGC TTGGCTTCCG TACCATTACT GAAATGGTTG
GGCGCTCTGA CATGCTTGAG GTTGATCCAG AAGTAGTGAA GAGCAACGAG AAACTTGAGA ACATTGATCT CTCATTGATT
TTGAAACCAG CTGCAGAGAT TCGCCCTGGG GCTGCTCAGT ACTGTGTTGA AAAGCAAGAT CATGGTCTTG ACATGGCATT
AGATAACAAA CTCATAGCTT TATCAAAAGC TGCACTTGAG AAGGAAGTTC GTGTTTTCAT TGAGACTCCA ATCCAGAATA
CTAACCGAGC AGTAGGCACT ATGCTTAGTC ATGAAGTCAC AAAGCGTTAT CACATGAAGG GATTACCTGC AGGTACGATT
CATGTGAAGC TCACTGGAAG TGCTGGTCAA AGTCTTGGCG CTTTTCTCTG TCCTGGAATC ACCCTTGAGC TTGAAGGAGA
CAGCAATGAT TATGTTGGCA AAGGATTGTC TGGCGGAAAA ATTGTTGTCT ACCCACCAAG AGATAGTACA TTTATTCCAG
AAGACAATAT TGTAATTGGT AATGTGGCTC TATATGGTGC TACTATAGGA GAGGCATATT TCAATGGAAT GGCTGCAGAA
AGGTTTTGCG TGCGCAATTC AGGTGCTCAA GCTGTGGTTG AAGGAATTGG TGATCATGGG TGTGAGTACA TGACAGGGGG
TACTGTGGTT ATCCTTGGTA AAACAGGAAG AAACTTTGCT GCTGGGATGA GTGGAGGCAT TGCTTATGTT TATGATATTG
ATGGGAAATT CAGCGTCCGC TGTAACCATG AGTTAGTTGA TCTCTATCAT GTGGAGGAAG AGGAAGACAT TACCACATTG
AAAATGATGA TAGAACAACA TCGACTTAAC ACTGGGAGTG TTGTTGCTAG AGATATACTC TCTAATTTTG ATACTCTTCT
TCCAAAATTT GTCAAGGTAT TCCCAAGAGA TTATAAGAGG GTTTTGGACA ATATGAAGGC TGAAAAGGCT GCTGCTAAGC
TTGCAAAGGA ACCAAAGATT TCAAATGGTG TTTCTGTAAC CACTAAGGTA GGGGATATTC TGAATTACTA AGTCTATTTT
ATTTTTGAAC TCATTAAAAT TTCACGATGG ACAAATAGCT TCAAGTGAGA AAAATGAAAA AAAGAGAGAA ACTTTTGAAT
TTACATTGAT TATATATGAA CGTGTATTCC ATATCTATAA TATTACCTTA GAAATAGCAA TTGTATATAC TACCATTGCT
CTGTAATATT GTTGGCTTAA TTAGATACTT AAATTTACAG AAAGTGCAAC CGGAGCAATC AACAAACCGA CCAACACGTG
TTTCCAATGC CAAAAAGTAC CGAGGTTTCA TTTCATATGA GCGAGAGAGT ATTTCTTACC GGGATCCAAA TGAGCGTGTA
AAAGATTGGA AGGAAGTTGC AATTGAATCA GTGCCAGGGC CACTACTGAA CACACAGTCT GCTCGTTGTA TGGATTGTGG
AACTCCTTTC TGTCATCAGG TAATATTCAG CTTTGTCCCC CTTTCATTGG TATTATTTTT GTTGGATTGT TGTTAGGTTA
AGGTTATTGT TTTCAATTTA TCTTACTGTT GAATTCAAGG ACAATGATGA GTAATTTTAC ATCTTAGACA GTAAAAAGTT
GCCACTATTT AGGCATTGAT AATACTTTTA TGATAACTTA ATCGTAGATA TTGTTTGTCT TAACTTGTCC AGAAAACTGC
TGGCTTGTTG CCTTTTTTTT TTCCCAAAAT TTGTTACTAA TATACCTCCT AATCATGGCT TGTGGTAATA TCTCTATGTA
GTGAGTACAC ATTAATGTAT TGTTTATCCA TTGAATGAAT ATTGTGATTC TTTTCATGGT GCTTATTATA AACTTCAATA
TTGTTGCAGG AAAGCTCAGG TGCTGGCTGT CCTCTTGGAA ATAAGATTCC AGAGTTCAAT GAACTGGTTC ACCAGAACAG
ATGGCGTGAA GCACTAGATC GTCTGCTTGA GACGAACAAC TTCCCTGAAT TTACTGGAAG AGTATGCCCT GCTCCCTGTG
AGGGATCATG TGTTCTTGGC ATTATTGAAA ATCCAGTATC TATCAAAAGC ATAGAATGTG CGATCATAGA CAAAGGTTTT
GAAGAGGGAT GGATGGTACC GCGGCCTCCA CTTCAAAGAA CAGGGTATTC TTTTGCGATG TCATTTTTTT TTGTCTAATT
TCCATCACGC TTTTAGTTGT TATTTCATTA CAAGGTAACA TCTGAGAAGC TATTAAAATA TGAACTCCTT GTTTTGCAGA
AAGAAGGTTG CCATCATTGG AAGTGGTCCG GCTGGTTTGG CTGCTGCAGA TCAACTAAAC AAAATGGGCC ATTTTGTTAC
TGTGTTTGAA CGTGCTGATC GTATTGGTGG TCTGATGATG TATGGAGTGC CAAACATGAA GACAGACAAG ATTGAAATTG
TGCAACGCCG TGTCAATTTA ATGGCAGAAG AGGGCATTAC ATTTGTAGTG AACGCTAATG TAGGCAGTGA TCCTTTGTAT
TCAATTGAGC GCCTCCGTTC TGAGAATGAT GCAGTCATTT TGGCTTGTGG AGCTACTAAA CCAAGGTAAC AGATCTAAAA
TGTCGAATCG ATCATTTCTA TCTTACCATG CTTTACTGGT GATGGTAGAT TGTTAAGTTC ATGAGAGCTA TCAGCAAAAG
TAAACCATAT GCTTGTATTA TGAGTTGACA TTTAAATGAT ATTTTGTTCA ACAGGGATCT AGGTATTCCT GGACGCGAGT
TATCAGGAGT TCATTTTGCC ATGGAGTTCC TCCATGCAAA TACGAAAAGT TTACTTGACA GCAACTTGGA GGATGGTAGA
TACATATCTG CCAAGGGGAA AAAGGTTGTG GTTATTGGTG GTGGTGACAC AGGCACAGAT TGCATTGGTA CATCTATTCG
GCATGGTTGC ACCAGCATTG TAAACCTTGA ACTTCTTACC AAACCACCAA GCAAGAGAGC AGCTGATAAC CCATGGCCAC
AGGTAAATAT ATGTCCCTAA ATGTGATAGA TTAGCTGGCT TGGCTAACCT TGCAGGAAGC TTTCATACAA AACAAGGCAC
ATCTGTAAAA TAGTTTCTTA TCATGGCCTT GGATCTGTTT TGCTCCTATC ATTTCCTATT GGGAATATGT TCTTATGTTT
TGTTTCTACT TGTAGTGGCC TAGAATCTTC CGTGTTGACT ATGGGCACCA GGAAGCATCT AGTAAGTTTG GAAATGACCC
AAGAACTTAC GAAGTCCTGA CCAAGCGTTT TATTGGTGAT GAAAATGGAA ACGTGAAGGC CCTTGAGGTG GTCCGGGTCA
AGTGGGAGAA AGTCGATGGG AGATTCCAGT TCAAAGAAAT TGAAGGCTCA AACGAGACCA TTGAGGCTGA TCTTGTCCTC
CTAGCTATGG GGTTCCTAGG CCCTGAAGCG GTTAGTTTTC CCCCATCACC AAAAGCGGTT AGTTATACTG TTGGGTAAGG
TTGGTGAGAA TGTTCATTAA ATAATAACAA GCTGTTTCCC TTTCTGCAGA CTATTGCTGA GAAACTAGGT TTGGAGAAAG
ACAACCGGTC TAACTTCAAA GCTCAATTTG GAAACTTTGC AACCAGTGTG GATGGCATTT TTGCTGCCGG GGACTGCAGA
CGTGGACAAT CACTTGTTGT TTGGGCCATC ACCGAGGGGC GGCAAGCTGC TGCAGCTGTC GACAAGTACT TGTCAAGGAA
TGAACAAGAT GCCGCAGAGG ACATAACCCC CTCGGGTGCA GGTTTTGTGC AGCCTGTTGC AGCATAAATG AAACAGGCAA
ACTTTTCAAG ACCAGTGCAA TCTAAATTAG GATCAACGTT TTTAGTCTTT GATCACAGCA AGTTGTCTTT GAAAGATAAG
GCCGGGCTCA ATAGGGAAAA GAGAAGAGCC TTCTTATATT TTGGTAGATA AACAATTGGA AATTTTGGTG TGTTCTGCTT
GTTACTTTTC CAGTAAAATG ATTTGCATGG TGAAATGCCG TTTTGTAATC TGAATAATAA TGTACAGTTG TTTTGGTTTA
ATTAATAGAT GTAAATTTGT CT

Locus: Os01g0681900

Loading...

Locus: Os01g0681900

Loading...