Os01t0691300-01

Locus

Os01g0691300

Description

Plant lipid transfer protein and hydrophobic protein, helical domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP2.2, OsLtpII.2

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 2.2, lipid transfer protein 2.2, type 2 non-specific lipid transfer protein 2

Transcript Evidence

AK242026 (DDBJ, Best hit)

Protein Evidence

NP_001043934.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Functional domain (InterPro)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

J075112P14 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0691300-01)

Others

Oryzabase (13531)

KEGG (Os01t0691300-01)

Transcript

489 bp

>Os01t0691300-01 Plant lipid transfer protein and hydrophobic protein, helical domain containing protein.
CATCCTAGCATCCCGGTGTCCAGCAAGAGATCCATCAAGCCGTCGCGATGACGACGAGGC
CTTCTGTTTTTTCCACCGTTGTCGCGGCGATCGCCATCGCCGCGCTGCTGAGCAGCCTCC
TCCTCCTGCAGGCTACCCCGGCCGCGGCCAGCGCGAGGGCCTCGAAGAAGGCTTCGTGCG
ACCTGATGCAGCTGAGCCCGTGCGTCAGCGCGTTCTCCGGTGTGGGGCAGGGCTCGCCAT
CGTCCGCGTGCTGCTCCAAGCTCAAGGCGCAGGGCTCCAGCTGCCTGTGCCTCTACAAGG
ACGACCCCAAAGTGAAGCGCATTGTCAGCTCCAATCGCACCAAGAGGGTCTTCACCGCGT
GCAAGGTGCCCGCGCCGAACTGCTAAGCCTTTGCATTTGACCATTGTTCAGTGAGGCAGA
AAACCTGTCACCGCTCGCAGTACTTCTCTCGAGAAAATTAGCAGTAATAAACTCAGTTGA
GTGCATAAC

CDS

339 bp

>Os01t0691300-01 Plant lipid transfer protein and hydrophobic protein, helical domain containing protein.
ATGACGACGAGGCCTTCTGTTTTTTCCACCGTTGTCGCGGCGATCGCCATCGCCGCGCTG
CTGAGCAGCCTCCTCCTCCTGCAGGCTACCCCGGCCGCGGCCAGCGCGAGGGCCTCGAAG
AAGGCTTCGTGCGACCTGATGCAGCTGAGCCCGTGCGTCAGCGCGTTCTCCGGTGTGGGG
CAGGGCTCGCCATCGTCCGCGTGCTGCTCCAAGCTCAAGGCGCAGGGCTCCAGCTGCCTG
TGCCTCTACAAGGACGACCCCAAAGTGAAGCGCATTGTCAGCTCCAATCGCACCAAGAGG
GTCTTCACCGCGTGCAAGGTGCCCGCGCCGAACTGCTAA

Protein

113 aa

>Os01t0691300-01 Plant lipid transfer protein and hydrophobic protein, helical domain containing protein.
MTTRPSVFSTVVAAIAIAALLSSLLLLQATPAAASARASKKASCDLMQLSPCVSAFSGVG
QGSPSSACCSKLKAQGSSCLCLYKDDPKVKRIVSSNRTKRVFTACKVPAPNC*

5'UTR

chr01:28539323..28539369 (- strand) : 47 bp

CDS

chr01:28538984..28539322 (- strand) : 339 bp

3'UTR

chr01:28538881..28538983 (- strand) : 103 bp

FASTA

>Os01t0691300-01 class=Sequence position=chr01:28538881..28539369 (- strand)
CATCCTAGCA TCCCGGTGTC CAGCAAGAGA TCCATCAAGC CGTCGCGATG ACGACGAGGC CTTCTGTTTT TTCCACCGTT
GTCGCGGCGA TCGCCATCGC CGCGCTGCTG AGCAGCCTCC TCCTCCTGCA GGCTACCCCG GCCGCGGCCA GCGCGAGGGC
CTCGAAGAAG GCTTCGTGCG ACCTGATGCA GCTGAGCCCG TGCGTCAGCG CGTTCTCCGG TGTGGGGCAG GGCTCGCCAT
CGTCCGCGTG CTGCTCCAAG CTCAAGGCGC AGGGCTCCAG CTGCCTGTGC CTCTACAAGG ACGACCCCAA AGTGAAGCGC
ATTGTCAGCT CCAATCGCAC CAAGAGGGTC TTCACCGCGT GCAAGGTGCC CGCGCCGAAC TGCTAAGCCT TTGCATTTGA
CCATTGTTCA GTGAGGCAGA AAACCTGTCA CCGCTCGCAG TACTTCTCTC GAGAAAATTA GCAGTAATAA ACTCAGTTGA
GTGCATAAC

Locus: Os01g0691300

Loading...

Locus: Os01g0691300

Loading...