Os01t0692000-01

Locus

Os01g0692000

Description

Similar to Glutathione S-transferase GSTU6.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GSTU40

CGSNL Gene Name

TAU GLUTATHIONE S-TRANSFERASE 40

Oryzabase Gene Symbol Synonym(s)

OsGSTU40

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK064650 (DDBJ, Best hit)

Protein Evidence

B6TLM5 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Glutathione S-transferase, C-terminal (IPR004046)

Glutathione S-transferase, C-terminal-like (IPR010987)

Glutathione S-transferase/chloride channel, C-terminal (IPR017933)

Full-length cDNA

002-114-D12 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0692000-01)

Others

Oryzabase (9557)

Transcript

1047 bp

>Os01t0692000-01 Similar to Glutathione S-transferase GSTU6.
ACAAACCGTAAAACCGATCCAGACAACAACAGCATCATACTCACACAGTTCGCGGCAGCA
ATGGCGGGAAGAGGAGGAGGAGGAGGAGGAGGCGAGCTGCAGCTGCTGGGCACATGGTAC
AGCCCGTACGCTATGCGCGCGAAAATcgcgctggggctcaagggcctgagctacgagtac
atcgagcaggacctcttcggcaagagcgagctcctgctcaagagcaacccggtgcacaag
aaggtccccgtcctcatccatgccggccggccggtgtgcgagtcgcgcgtggttctcgag
tacgtcgacgaggcctggcccggggccgcgccgccgctcctcccggccgacccccacgac
cgcgccaccgctcgcttctgggcgacctacttcgacagcacggtaatcGATGGCATCTTC
CTGAAGAAATCAACCTTAGATAGATAGCAACGTTCATGTCGGTGATTGAGAAATCAATAT
TAGAGAGATCGACATTTTTGTTTTGATACTGTATTAAGTTCTTCCCGCCGTGGAGGGCGC
TGATGAGGGCGACGACGGCGGAGCAGAGAGCGGAGGCCTTCATGAACGCCGTACCTCAGG
TGGAGGTGCTGGAGCGAGCGTTCGTGGAGTGCTCCAAGGGGAAGGCGTTCTTCGGCGGCG
ACGCCGTCGGGCTCGTCGACGTCGTGGTCGGCGGCTTCGTGGTGTGGTTCAAGGTGGTGG
ACGAGGTGGCCGGCTCCAGCCTCCTCGACGAGGCCAAGTTCCCGGGCCTGGCGGCGTGGG
CGGAGCGGTTCTTGGCGGTGGACGCCGTCCGGGAGGCGATGCCCGACGCCGGGAAGCTCC
TGGAGCACTACAAGGGATTTCTGGCTAAATTGGCTTCGCCAGCTGGTTCTACCTAATGGC
AATCTATCTGCCTTGCTCGCCTGCTTTGACGATGAAGAAGTTGTTTGGTACTGTGTCATG
TGAAAATATTTTGTTAGTCTCTGTTGAGCGGTGTTCAGAATGCAAATGTGTACATCTTGA
ATAAAAGGAGAGCAAAATAGTGAGGCG

CDS

390 bp

>Os01t0692000-01 Similar to Glutathione S-transferase GSTU6.
TACTGTATTAAGTTCTTCCCGCCGTGGAGGGCGCTGATGAGGGCGACGACGGCGGAGCAG
AGAGCGGAGGCCTTCATGAACGCCGTACCTCAGGTGGAGGTGCTGGAGCGAGCGTTCGTG
GAGTGCTCCAAGGGGAAGGCGTTCTTCGGCGGCGACGCCGTCGGGCTCGTCGACGTCGTG
GTCGGCGGCTTCGTGGTGTGGTTCAAGGTGGTGGACGAGGTGGCCGGCTCCAGCCTCCTC
GACGAGGCCAAGTTCCCGGGCCTGGCGGCGTGGGCGGAGCGGTTCTTGGCGGTGGACGCC
GTCCGGGAGGCGATGCCCGACGCCGGGAAGCTCCTGGAGCACTACAAGGGATTTCTGGCT
AAATTGGCTTCGCCAGCTGGTTCTACCTAA

Protein

130 aa

>Os01t0692000-01 Similar to Glutathione S-transferase GSTU6.
YCIKFFPPWRALMRATTAEQRAEAFMNAVPQVEVLERAFVECSKGKAFFGGDAVGLVDVV
VGGFVVWFKVVDEVAGSSLLDEAKFPGLAAWAERFLAVDAVREAMPDAGKLLEHYKGFLA
KLASPAGST*

5'UTR

chr01:28567179..28567684 (- strand) : 506 bp

CDS

chr01:28566789..28567178 (- strand) : 390 bp

3'UTR

chr01:28566638..28566788 (- strand) : 151 bp

FASTA

>Os01t0692000-01 class=Sequence position=chr01:28566638..28567684 (- strand)
ACAAACCGTA AAACCGATCC AGACAACAAC AGCATCATAC TCACACAGTT CGCGGCAGCA ATGGCGGGAA GAGGAGGAGG
AGGAGGAGGA GGCGAGCTGC AGCTGCTGGG CACATGGTAC AGCCCGTACG CTATGCGCGC GAAAATcgcg ctggggctca
agggcctgag ctacgagtac atcgagcagg acctcttcgg caagagcgag ctcctgctca agagcaaccc ggtgcacaag
aaggtccccg tcctcatcca tgccggccgg ccggtgtgcg agtcgcgcgt ggttctcgag tacgtcgacg aggcctggcc
cggggccgcg ccgccgctcc tcccggccga cccccacgac cgcgccaccg ctcgcttctg ggcgacctac ttcgacagca
cggtaatcGA TGGCATCTTC CTGAAGAAAT CAACCTTAGA TAGATAGCAA CGTTCATGTC GGTGATTGAG AAATCAATAT
TAGAGAGATC GACATTTTTG TTTTGATACT GTATTAAGTT CTTCCCGCCG TGGAGGGCGC TGATGAGGGC GACGACGGCG
GAGCAGAGAG CGGAGGCCTT CATGAACGCC GTACCTCAGG TGGAGGTGCT GGAGCGAGCG TTCGTGGAGT GCTCCAAGGG
GAAGGCGTTC TTCGGCGGCG ACGCCGTCGG GCTCGTCGAC GTCGTGGTCG GCGGCTTCGT GGTGTGGTTC AAGGTGGTGG
ACGAGGTGGC CGGCTCCAGC CTCCTCGACG AGGCCAAGTT CCCGGGCCTG GCGGCGTGGG CGGAGCGGTT CTTGGCGGTG
GACGCCGTCC GGGAGGCGAT GCCCGACGCC GGGAAGCTCC TGGAGCACTA CAAGGGATTT CTGGCTAAAT TGGCTTCGCC
AGCTGGTTCT ACCTAATGGC AATCTATCTG CCTTGCTCGC CTGCTTTGAC GATGAAGAAG TTGTTTGGTA CTGTGTCATG
TGAAAATATT TTGTTAGTCT CTGTTGAGCG GTGTTCAGAA TGCAAATGTG TACATCTTGA ATAAAAGGAG AGCAAAATAG
TGAGGCG

Locus: Os01g0692000

Loading...

Locus: Os01g0692000

Loading...