Os01t0699100-01

Locus

Os01g0699100

Description

MAP kinase kinase kinase, Salt stress response, Seed dormancy control

RAP-DB Gene Symbol Synonym(s)

OsMAPKKK63

RAP-DB Gene Name Synonym(s)

MAP kinase kinase kinase 63

CGSNL Gene Symbol

MAPKKK63

CGSNL Gene Name

MAP KINASE KINASE KINASE 63

Oryzabase Gene Symbol Synonym(s)

OsMAPKKK63

Oryzabase Gene Name Synonym(s)

MAP kinase kinase kinase 63

Transcript Evidence

AK058518 (truncated)

Inferred from literature

Protein Evidence

B8QUI7

Literature

PMID: 30764706

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

June 8, 2020

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain superfamily (IPR011009)

Protein kinase domain (IPR000719)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

cytosol (GO:0005829)

Full-length cDNA

001-016-H04(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os01t0699100-01)

Others

Oryzabase (23737)

Transcript

1588 bp

>Os01t0699100-01 MAP kinase kinase kinase, Salt stress response, Seed dormancy control
AACTCAGACCGAACAAAAGGATCACCAGCTCAGAGCTCACCACCACCACCACCAACAACA
ACAACAACGCATTGCAAAGCAAGGAGAAATCCGAAGTCCAACAACACCCACAAGAAAAGA
GAAGAAGCGGGGAATGGCGATCGCCGTGAGCGGGCGCTGGACGCGGCTGCGGACGCTGGG
CCGTGGCGCGTCGGGCGCCGTGGTGTCGCTGGCGGAGGACGGCGCGTCGGGGGAGCTGTT
CGCGGTCAAGACCGCGGCCGCGGCGGAGGCGGCGATGCTGAGGAGGGAGCGGGGGATGAT
GTCTGGGCTGTCCTCGCCACACGTCGTGCCCTGCATCGGCGGCGGCGATGGCCCCGACGG
GTCATACAATCTCTTCCTTGAGTTCGCCCCCGGGGGATCGCTCGCCAACGAGGTTGCCAG
GGATGGGGGACGCCTCGAGGAGCGCGCGATCAGGGTGTACGCGGCGGATGTCCTGCGCgg
gctgacgtacctccacgggatgtcgctcgtacacggggatgtcaaggcggacaacatagt
gatcggtgtcgacgggctcgccaagctcgccgacttcgggtgtgcgaaaaccatggattc
ggagcggccggtcagcggcacacctgcgttcatggcgccggaggttgcccgcggggagGA
GCAGGGGCCAGCGGCAGACGTTTGGGCTCTTGGCTGCACGGTCATCGAGATGGCCACCGG
GCGCGCGCCGTGGAGCGACATGGACGACGTCCTCGCCGCCGTCCACCGGATTGGGTACAC
GGACGCCGTGCCGGAGGTGCCGGTTTGGCTGTCCGCAGAGGCGAAGGACTTCTTGGCCAT
GTGTTTTGCGAGAAACGCCGGCGACCGGAGCACCGCGGCACAGCTCTTGGAGCATCCGTT
CGTGGCATTCGCCTGCCACGAAGTCAAGGCCGCGCAGCCGAAGCCCAGGTGGGTCTCTCC
GAAGAGCACACTGGACGCCGCATTCTGGGAGTCGGAGACCGACGACGAGGAGGAGGTCGA
CGAGATAACAGAGAGCCTCTGCGATAGGATCAAGTCATTGGCGTGCCCTGTTTCGGCCTT
GCCGGATTGGGACTCCGACGAAGGCTGGATCGATCTGCTCGGCGAGCAGTGCGAGGCTTG
CGATTCGGAAGCGGCCAGGGAATCGATTGATGTGGCGCGTAGCGCGCCAAGCAAAGTGTC
CAGCGCGGCGACGGTGCCAGCTGCTGAAGTGGTGCTTGTCGGCGGCGGCTGCTGTCCAAG
CAATGAAGCGGACGCTTTCGATCAGTCAATTGGTGGCGATATCCAAGCCGCTGATCGTTC
AATCGAGCGTCGGAATAAAGTCTGCGCTGGTTCAGACAATGATGTACTTCCATTTCGATT
AGTATGTAACGGAATTTGTGCAATGGAATTCTTTCAGTTTTTCACAAATCTTGCTGTGCT
GTTATGTTTGATTCCCTCCGTTCCCACTATGTTTTCGTCAAATTGTGAGCTACGCCCATG
CCTAGAGCAAAAGCTCAGTCCATACGCACCACGAAATATTTCTATTCAACTTTATTACGT
AAGTAACCACGCAATAATAAACAACTAA

CDS

1455 bp

>Os01t0699100-01 MAP kinase kinase kinase, Salt stress response, Seed dormancy control
ATGGCGATCGCCGTGAGCGGGCGCTGGACGCGGCTGCGGACGCTGGGCCGTGGCGCGTCG
GGCGCCGTGGTGTCGCTGGCGGAGGACGGCGCGTCGGGGGAGCTGTTCGCGGTCAAGACC
GCGGCCGCGGCGGAGGCGGCGATGCTGAGGAGGGAGCGGGGGATGATGTCTGGGCTGTCC
TCGCCACACGTCGTGCCCTGCATCGGCGGCGGCGATGGCCCCGACGGGTCATACAATCTC
TTCCTTGAGTTCGCCCCCGGGGGATCGCTCGCCAACGAGGTTGCCAGGGATGGGGGACGC
CTCGAGGAGCGCGCGATCAGGGTGTACGCGGCGGATGTCCTGCGCgggctgacgtacctc
cacgggatgtcgctcgtacacggggatgtcaaggcggacaacatagtgatcggtgtcgac
gggctcgccaagctcgccgacttcgggtgtgcgaaaaccatggattcggagcggccggtc
agcggcacacctgcgttcatggcgccggaggttgcccgcggggagGAGCAGGGGCCAGCG
GCAGACGTTTGGGCTCTTGGCTGCACGGTCATCGAGATGGCCACCGGGCGCGCGCCGTGG
AGCGACATGGACGACGTCCTCGCCGCCGTCCACCGGATTGGGTACACGGACGCCGTGCCG
GAGGTGCCGGTTTGGCTGTCCGCAGAGGCGAAGGACTTCTTGGCCATGTGTTTTGCGAGA
AACGCCGGCGACCGGAGCACCGCGGCACAGCTCTTGGAGCATCCGTTCGTGGCATTCGCC
TGCCACGAAGTCAAGGCCGCGCAGCCGAAGCCCAGGTGGGTCTCTCCGAAGAGCACACTG
GACGCCGCATTCTGGGAGTCGGAGACCGACGACGAGGAGGAGGTCGACGAGATAACAGAG
AGCCTCTGCGATAGGATCAAGTCATTGGCGTGCCCTGTTTCGGCCTTGCCGGATTGGGAC
TCCGACGAAGGCTGGATCGATCTGCTCGGCGAGCAGTGCGAGGCTTGCGATTCGGAAGCG
GCCAGGGAATCGATTGATGTGGCGCGTAGCGCGCCAAGCAAAGTGTCCAGCGCGGCGACG
GTGCCAGCTGCTGAAGTGGTGCTTGTCGGCGGCGGCTGCTGTCCAAGCAATGAAGCGGAC
GCTTTCGATCAGTCAATTGGTGGCGATATCCAAGCCGCTGATCGTTCAATCGAGCGTCGG
AATAAAGTCTGCGCTGGTTCAGACAATGATGTACTTCCATTTCGATTAGTATGTAACGGA
ATTTGTGCAATGGAATTCTTTCAGTTTTTCACAAATCTTGCTGTGCTGTTATGTTTGATT
CCCTCCGTTCCCACTATGTTTTCGTCAAATTGTGAGCTACGCCCATGCCTAGAGCAAAAG
CTCAGTCCATACGCACCACGAAATATTTCTATTCAACTTTATTACGTAAGTAACCACGCA
ATAATAAACAACTAA

Protein

485 aa

>Os01t0699100-01 MAP kinase kinase kinase, Salt stress response, Seed dormancy control
MAIAVSGRWTRLRTLGRGASGAVVSLAEDGASGELFAVKTAAAAEAAMLRRERGMMSGLS
SPHVVPCIGGGDGPDGSYNLFLEFAPGGSLANEVARDGGRLEERAIRVYAADVLRGLTYL
HGMSLVHGDVKADNIVIGVDGLAKLADFGCAKTMDSERPVSGTPAFMAPEVARGEEQGPA
ADVWALGCTVIEMATGRAPWSDMDDVLAAVHRIGYTDAVPEVPVWLSAEAKDFLAMCFAR
NAGDRSTAAQLLEHPFVAFACHEVKAAQPKPRWVSPKSTLDAAFWESETDDEEEVDEITE
SLCDRIKSLACPVSALPDWDSDEGWIDLLGEQCEACDSEAARESIDVARSAPSKVSSAAT
VPAAEVVLVGGGCCPSNEADAFDQSIGGDIQAADRSIERRNKVCAGSDNDVLPFRLVCNG
ICAMEFFQFFTNLAVLLCLIPSVPTMFSSNCELRPCLEQKLSPYAPRNISIQLYYVSNHA
IINN*

5'UTR

chr01:28921498..28921630 (+ strand) : 133 bp

CDS

chr01:28921631..28923085 (+ strand) : 1455 bp

FASTA

>Os01t0699100-01 class=Sequence position=chr01:28921498..28923085 (+ strand)
AACTCAGACC GAACAAAAGG ATCACCAGCT CAGAGCTCAC CACCACCACC ACCAACAACA ACAACAACGC ATTGCAAAGC
AAGGAGAAAT CCGAAGTCCA ACAACACCCA CAAGAAAAGA GAAGAAGCGG GGAATGGCGA TCGCCGTGAG CGGGCGCTGG
ACGCGGCTGC GGACGCTGGG CCGTGGCGCG TCGGGCGCCG TGGTGTCGCT GGCGGAGGAC GGCGCGTCGG GGGAGCTGTT
CGCGGTCAAG ACCGCGGCCG CGGCGGAGGC GGCGATGCTG AGGAGGGAGC GGGGGATGAT GTCTGGGCTG TCCTCGCCAC
ACGTCGTGCC CTGCATCGGC GGCGGCGATG GCCCCGACGG GTCATACAAT CTCTTCCTTG AGTTCGCCCC CGGGGGATCG
CTCGCCAACG AGGTTGCCAG GGATGGGGGA CGCCTCGAGG AGCGCGCGAT CAGGGTGTAC GCGGCGGATG TCCTGCGCgg
gctgacgtac ctccacggga tgtcgctcgt acacggggat gtcaaggcgg acaacatagt gatcggtgtc gacgggctcg
ccaagctcgc cgacttcggg tgtgcgaaaa ccatggattc ggagcggccg gtcagcggca cacctgcgtt catggcgccg
gaggttgccc gcggggagGA GCAGGGGCCA GCGGCAGACG TTTGGGCTCT TGGCTGCACG GTCATCGAGA TGGCCACCGG
GCGCGCGCCG TGGAGCGACA TGGACGACGT CCTCGCCGCC GTCCACCGGA TTGGGTACAC GGACGCCGTG CCGGAGGTGC
CGGTTTGGCT GTCCGCAGAG GCGAAGGACT TCTTGGCCAT GTGTTTTGCG AGAAACGCCG GCGACCGGAG CACCGCGGCA
CAGCTCTTGG AGCATCCGTT CGTGGCATTC GCCTGCCACG AAGTCAAGGC CGCGCAGCCG AAGCCCAGGT GGGTCTCTCC
GAAGAGCACA CTGGACGCCG CATTCTGGGA GTCGGAGACC GACGACGAGG AGGAGGTCGA CGAGATAACA GAGAGCCTCT
GCGATAGGAT CAAGTCATTG GCGTGCCCTG TTTCGGCCTT GCCGGATTGG GACTCCGACG AAGGCTGGAT CGATCTGCTC
GGCGAGCAGT GCGAGGCTTG CGATTCGGAA GCGGCCAGGG AATCGATTGA TGTGGCGCGT AGCGCGCCAA GCAAAGTGTC
CAGCGCGGCG ACGGTGCCAG CTGCTGAAGT GGTGCTTGTC GGCGGCGGCT GCTGTCCAAG CAATGAAGCG GACGCTTTCG
ATCAGTCAAT TGGTGGCGAT ATCCAAGCCG CTGATCGTTC AATCGAGCGT CGGAATAAAG TCTGCGCTGG TTCAGACAAT
GATGTACTTC CATTTCGATT AGTATGTAAC GGAATTTGTG CAATGGAATT CTTTCAGTTT TTCACAAATC TTGCTGTGCT
GTTATGTTTG ATTCCCTCCG TTCCCACTAT GTTTTCGTCA AATTGTGAGC TACGCCCATG CCTAGAGCAA AAGCTCAGTC
CATACGCACC ACGAAATATT TCTATTCAAC TTTATTACGT AAGTAACCAC GCAATAATAA ACAACTAA

Locus: Os01g0699100

Loading...

Locus: Os01g0699100

Loading...