Os01t0713600-01

Locus

Os01g0713600

Description

B3 DNA-binding domain-containing transcription factor, Flowering time regulation, Repression of flowering activator Ehd1 and its downstream genes by binding to the promoter of the Ehd1 gene

RAP-DB Gene Symbol Synonym(s)

OsLFL1

RAP-DB Gene Name Synonym(s)

LEC2 and FUSCA3 Like 1, LEAFY COTYLEDON 2 and FUSCA 3-LIKE 1

CGSNL Gene Symbol

LFL1

CGSNL Gene Name

LATE-FLOWERING 1

Oryzabase Gene Symbol Synonym(s)

OsLFL1, OsSTA29, STA29

Oryzabase Gene Name Synonym(s)

B3 domain-containing protein LFL1, LEC2 and FUSCA3-like protein 1, LEAFY COTYLEDON 2 and FUSCA 3-LIKE 1, LEC2/FUS3-LIKE 1

Transcript Evidence

EF521182 (Zhonghua 11)

AK109920 (truncated)

Protein Evidence

A4LBC0

Literature

PMID: 17913295

PMID: 17592727

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

July 6, 2017

Gene Ontology (GO)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

DNA-binding pseudobarrel domain (IPR015300)

B3 DNA binding domain (IPR003340)

Experimentally confirmed subcellular location

nucleus

Full-length cDNA

002-150-E10(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os01t0713600-01)

RiceXPro (AK109920)

Others

Oryzabase (7152)

KEGG (Os01t0713600-01)

Transcript

1459 bp

>Os01t0713600-01 B3 DNA-binding domain-containing transcription factor, Flowering time regulation, Repression of flowering activator Ehd1 and its downstream genes by binding to the promoter of the Ehd1 gene
AGAGAGAGAGGGAGAGCCATTCGGCGCGGCGCCCGCAGGGAATCCCGATGCGGGGGGAGG
AGAGATGGCAGGAGCAGCCAGCCCTCGCCTCCCACCCGTCGCGTGCCACCTTGCGCCCGC
GCGGTTGGCCGCGCCTCGGCCTCGCCCCGACGGGCGTTGGCTCCTCCTGCCCACCTGCAC
CCGCCTCAGAGCTCGCACGCCACTTGGCGCGCCGCGCCCCCGTCTCCGCGTCTCCGCCCG
TCCTCCCTCCTATAAAAGACCAGGGAGCGCGGCCCCCAACCCTAGCCGCCTCCGCCGCCG
CAGCGTCCTCGCCTCCTCCTCCTCCTCCTCCTCCAATTCCTCCTCTTCCTCCCTCCACCT
CGACCTCCGCCGCCCGTCCCACCGACATGGCCGGGGTCACCAGCAAGCGCCGATCCTCCT
CCGCCTCCACCTCCTCCTCCTCCGGCGACGGCGCCGCCGTCTCCGACCGGCCGCGGGGGG
TGACCCGGAAGCGCAGGTCCGGCGGCCGTTGCCCCCGCCCCGCCGCCTCCCTGAGGCCGG
CCGCGCCCCGACCCTCCTCTCACCACACTGCTGGATTGAGAGTAATTCTGCAAAAGGAAC
TACGGTACAGCGACGTAAGCCAGCTAGGGAGAATTGTTCTCCCGAAGAAAGAGGCAGAGG
CTTACCTACCAATTCTGACATCAAAGGATGGCAAGAAAAGTTTATGTATGCATGATTTGC
AAAATGCACAACTCTGGACCTTCAAGTACAGGTATTGGCCCAACAACAAGAGCAGGATGT
ATGTACTTGAGAATACCGGGGATTATGTCAGAACCCATGATCTTCAACTAGGAGACTCCA
TTGTGATATACAAAGATGATGAGAATAACCGATTTGTCATCGGAGCAAAGAAGGCAGGTG
ATCAACAAGCTGCCACTGTGCCACAAGTTGACGAGCATATCTCTACCCTCTTCCCCATTT
TTCCAATTGCACAAGTCGATGACTATCTCTCTCCCATGGCACCACAAGTTGATATCTCTG
CCTTCGTGCCACATGCTGATGAGAACCATGAGATATTTGACGGGATACTGAATTCTCTGC
CAGAGATACCAGTAGCCAATGTGAGGTATTCTGACTTCTTCGACCCATTCGATGATGGTA
TGGACATGGCAAACACTCTGAACGCCAACGCCAACCAGTCTGCTAGTCTGCATGTCACTG
ATGATAAGTCTGGGCATTCCTTGATTCCCAACCCAAAGTCTGGGCCTCACATGTGAGACT
GACAGGGAAGTGGTATTTCATACCATGGTCAGTTTGTATGAAGCTCAGAAACCCCTTCCC
TGGCGCCATTGTTGTACATCCAAATAATTGGTGTCCTTATTTTGACGCTGTATATGCTAA
CTGCTACATGCAGTTTTATGTGTAAAATATTTTGTTCACAACCCAACTGGAGGTTTAATC
AGATGAAACATTGTAACTC

CDS

1209 bp

>Os01t0713600-01 B3 DNA-binding domain-containing transcription factor, Flowering time regulation, Repression of flowering activator Ehd1 and its downstream genes by binding to the promoter of the Ehd1 gene
ATGCGGGGGGAGGAGAGATGGCAGGAGCAGCCAGCCCTCGCCTCCCACCCGTCGCGTGCC
ACCTTGCGCCCGCGCGGTTGGCCGCGCCTCGGCCTCGCCCCGACGGGCGTTGGCTCCTCC
TGCCCACCTGCACCCGCCTCAGAGCTCGCACGCCACTTGGCGCGCCGCGCCCCCGTCTCC
GCGTCTCCGCCCGTCCTCCCTCCTATAAAAGACCAGGGAGCGCGGCCCCCAACCCTAGCC
GCCTCCGCCGCCGCAGCGTCCTCGCCTCCTCCTCCTCCTCCTCCTCCAATTCCTCCTCTT
CCTCCCTCCACCTCGACCTCCGCCGCCCGTCCCACCGACATGGCCGGGGTCACCAGCAAG
CGCCGATCCTCCTCCGCCTCCACCTCCTCCTCCTCCGGCGACGGCGCCGCCGTCTCCGAC
CGGCCGCGGGGGGTGACCCGGAAGCGCAGGTCCGGCGGCCGTTGCCCCCGCCCCGCCGCC
TCCCTGAGGCCGGCCGCGCCCCGACCCTCCTCTCACCACACTGCTGGATTGAGAGTAATT
CTGCAAAAGGAACTACGGTACAGCGACGTAAGCCAGCTAGGGAGAATTGTTCTCCCGAAG
AAAGAGGCAGAGGCTTACCTACCAATTCTGACATCAAAGGATGGCAAGAAAAGTTTATGT
ATGCATGATTTGCAAAATGCACAACTCTGGACCTTCAAGTACAGGTATTGGCCCAACAAC
AAGAGCAGGATGTATGTACTTGAGAATACCGGGGATTATGTCAGAACCCATGATCTTCAA
CTAGGAGACTCCATTGTGATATACAAAGATGATGAGAATAACCGATTTGTCATCGGAGCA
AAGAAGGCAGGTGATCAACAAGCTGCCACTGTGCCACAAGTTGACGAGCATATCTCTACC
CTCTTCCCCATTTTTCCAATTGCACAAGTCGATGACTATCTCTCTCCCATGGCACCACAA
GTTGATATCTCTGCCTTCGTGCCACATGCTGATGAGAACCATGAGATATTTGACGGGATA
CTGAATTCTCTGCCAGAGATACCAGTAGCCAATGTGAGGTATTCTGACTTCTTCGACCCA
TTCGATGATGGTATGGACATGGCAAACACTCTGAACGCCAACGCCAACCAGTCTGCTAGT
CTGCATGTCACTGATGATAAGTCTGGGCATTCCTTGATTCCCAACCCAAAGTCTGGGCCT
CACATGTGA

Protein

403 aa

>Os01t0713600-01 B3 DNA-binding domain-containing transcription factor, Flowering time regulation, Repression of flowering activator Ehd1 and its downstream genes by binding to the promoter of the Ehd1 gene
MRGEERWQEQPALASHPSRATLRPRGWPRLGLAPTGVGSSCPPAPASELARHLARRAPVS
ASPPVLPPIKDQGARPPTLAASAAAASSPPPPPPPPIPPLPPSTSTSAARPTDMAGVTSK
RRSSSASTSSSSGDGAAVSDRPRGVTRKRRSGGRCPRPAASLRPAAPRPSSHHTAGLRVI
LQKELRYSDVSQLGRIVLPKKEAEAYLPILTSKDGKKSLCMHDLQNAQLWTFKYRYWPNN
KSRMYVLENTGDYVRTHDLQLGDSIVIYKDDENNRFVIGAKKAGDQQAATVPQVDEHIST
LFPIFPIAQVDDYLSPMAPQVDISAFVPHADENHEIFDGILNSLPEIPVANVRYSDFFDP
FDDGMDMANTLNANANQSASLHVTDDKSGHSLIPNPKSGPHM*

5'UTR

chr01:29637792..29637838 (+ strand) : 47 bp

CDS

chr01:29637839..29638351 (+ strand) : 513 bp

chr01:29639963..29640049 (+ strand) : 87 bp

chr01:29640658..29640761 (+ strand) : 104 bp

chr01:29641989..29642035 (+ strand) : 47 bp

chr01:29642123..29642199 (+ strand) : 77 bp

chr01:29642279..29642659 (+ strand) : 381 bp

3'UTR

chr01:29642660..29642862 (+ strand) : 203 bp

FASTA

>Os01t0713600-01 class=Sequence position=chr01:29637792..29642862 (+ strand)
AGAGAGAGAG GGAGAGCCAT TCGGCGCGGC GCCCGCAGGG AATCCCGATG CGGGGGGAGG AGAGATGGCA GGAGCAGCCA
GCCCTCGCCT CCCACCCGTC GCGTGCCACC TTGCGCCCGC GCGGTTGGCC GCGCCTCGGC CTCGCCCCGA CGGGCGTTGG
CTCCTCCTGC CCACCTGCAC CCGCCTCAGA GCTCGCACGC CACTTGGCGC GCCGCGCCCC CGTCTCCGCG TCTCCGCCCG
TCCTCCCTCC TATAAAAGAC CAGGGAGCGC GGCCCCCAAC CCTAGCCGCC TCCGCCGCCG CAGCGTCCTC GCCTCCTCCT
CCTCCTCCTC CTCCAATTCC TCCTCTTCCT CCCTCCACCT CGACCTCCGC CGCCCGTCCC ACCGACATGG CCGGGGTCAC
CAGCAAGCGC CGATCCTCCT CCGCCTCCAC CTCCTCCTCC TCCGGCGACG GCGCCGCCGT CTCCGACCGG CCGCGGGGGG
TGACCCGGAA GCGCAGGTCC GGCGGCCGTT GCCCCCGCCC CGCCGCCTCC CTGAGGCCGG CCGCGCCCCG ACCCTCCTCT
GTGAGTGCCT CGGAATTCAC GGACTCTCCT CCTGTTCCGC GGTTTTGCTT GGTTTCTCCG TATATGCGTG GAGATGGTGG
GCCGTTGGTG TTGTCGGGGA GGCGCCGTGG GCTGGAGGCC CAGGCGAGAG AGGGGCGATC GTCGGCTCGT TCCACTGGTC
CCAACGTCGC CGGATTATAA AATTTTGGTT GGAAGAAGCT CGCAGATGTG TTGATCTTCC TGGGCGATTT GGAGCCCTGA
TTTGCTCGAT TGGGGAAATC TGATCAACGA ATTTCCTCGA TTCCAGTAGC TGACTCGAAT ACCATGATCA GATTTGAGCG
ATCTATGTGT ACGGTGTTTG ATCAATCGAC ATTTTTTTTA GGAAAAACTT GGCTCTCGTT TTTGCTTCAG GCGTGATCCG
TATTGCTTAA GTCATAGGTT ATGGCAAGGA ATAATTGGGG CGGTTCTTTG TCGGATTCCT GATAGCGATA GCTCGTTCCA
GGGTAGTTTT TTTTTTTTTT TTGTCAGTGA TGATTAGTAT AAGTGTATAA CATCCATGTT CCTGGGTCAA TCAGAGATGG
ATTTCGTGGT CCACGTGCCG TGTCACGTGA CACATGAATA GACGATTTGC TGTGGCGCCC TGTGGGCTTA ATCTTTGCCC
TTTTCAGGGT AGTAACAATC GCATAATCAG TGGATCGTCT TCGTCAATTT GTTGATTTAG TTATGTTAAG TATTTTGGGG
TGTTCGGTGC TCTTTTTGTT GTATTTATAT GTTAGGAATG CTGAAAAGTT GGTAGAAATT GTCGGTATTT GTGTATGCTC
TCAGCAGCTT GCTGCATCAC AAAGTTGGTA GGAGTTGGCA GTACATGCCA TGCCATGTCA ACTCGCCATG GTTTGCCGTA
CAAGTGAATC TTCGATGGGA ACTGATACAT TCTGGCCAGA ACATGGAGCA TAGAAGTGAT TACATTAGTC ATCACACTAG
CTGATACATG AAAGTGCCAG TATAGTATAA GGTTTACATT TTGGACCTTA GGTTAGTTCT TGACCTCTAA TGTCCAGGTA
ACCCTCCATT TTAGATAAAT GCTTGTTTTT GTCTCCATGT TTTATGTCAA CAACTGGACC ATATGAAATC TCTACTTCTT
AAAAAAAACT GTGGGGGAAT TTTCTTCCCT GTTTGTAAAG AGCGATGCAC GTGCAAGAAC TAGGCACAAA TCGGGGATAT
GTGTTCTTAG TGGAGTAATT TCTATTACTA ATGGTGGGTA TAACTGGTGT AGGAAGGTAT GGATAGTACG GTAATGAAAT
GTTAGTTATA CATACTGACA AACACTTTTC TGATTATTTT AACCTGGTCA TCATGCAAGC AAGTGTGGTG AAACCATTTG
CAAATAGAAA AGGGGGTTGA CTGTGTATGG TCCATGAATT CAAATCTGCC ACACTTCATG TATTCTGCCT AAATGGACTT
CATCTTCTGA TGATAGGTAA ACATGTTGGA TTTGAATAGA GCTATCCTTG ATTCAGATGT AAGATTTATG CAGAAAACCG
AGTGACTATT TCTTTTCTTC ATGGAAAAGG GCAGATTTAT TCGAACGTAA TTCACATTTC TGAATTGCAA GCTTCTCCAA
TGTTTATGTA GCACCACACT GCTGGATTGA GAGTAATTCT GCAAAAGGAA CTACGGTACA GCGACGTAAG CCAGCTAGGG
AGAATTGTTC TCCCGAAGGT CTGTTCTGAT GCAAATCTAT GACATGTTCC TTTTTTGGGG GGTATTTGCT TCAGTACACC
TCTTAATAAT TATGTGAATC TTTAATGTCT ATTAATGATA AAAGTGAACC ATCTTAATCA AGAACCAGTT AGGTGAACAT
CATTGGTTTT TGGTGGCAGC ATGGATGGTA AAATCATGTA GGATTTCTGG TGGCATCCAA TAAGAAAATA GAGAACAAGG
ATCAAAAGTG CAAACATTAG TTCTTGAATA AAATGAGCTT CTCTTGACGT GAATAGCATG AATATACTGG TAAATACTTG
GGGATGATGA ATCTGTAAAT TAGCACTACT TGTCACAGAT CAAATGTTTG TGCTATAAGC AGAAAGAATA TGCTGATAAG
TACTTGGAGA TGACAGATCT ATATAATATT ATATTCCCTA TAGGTTGACA GCATTAGGTC TTTGTTTTAA ACCATAGAGA
TCAAATCTAA TTTTTATTCA GATTCATCCC TTTGTTAGTA AAACTAATGT TTCTTCATAT TCACAAACTC TTCTTATATA
GGATTACTGA AGCAAACCTG TCTTTTTATA CACCTGACAC TTGTCTCTGA TGAATGAATT CCTCAGAAAG AGGCAGAGGC
TTACCTACCA ATTCTGACAT CAAAGGATGG CAAGAAAAGT TTATGTATGC ATGATTTGCA AAATGCACAA CTCTGGACCT
TCAAGTACAG GTTGAACAGT TTGTCTATTT GGCTTTAAAT TTGTTGTTAC CATGGCTTCC TCTGCCAATA ACCATCTGAG
TCATACTTTA TTTTCAATGA TGCATTAATT TCAACTTTAT TGTATGTATG AATTCTCTTA ACGCTTTGAT ATTAGGTTGT
TTCCTCTTAA TGAAATGTAT TTTCTTTAGT GTGTTTGCGC CTATTTTGCC ATATCCAACA AGAAATTAGT TCTTCTATAT
TGGGTAGACT TTGAAAAATA ATACGGTTGC AACATGTATA TGGATTCTGT TAGGAATGTT GTTGTTTTAT ATACCATCCT
CATCTCTTTG AATTTACTCA CATTTATTTG TTGAGCTTTT TATGTCCTTG GGAAGGTAGC AAACCTAACT CTGTACATTT
TGAATGATGG tttttttaga taatggaata aaattccagc atttgctcac agagctaaaa ccaattatta caaaaattgg
gaacaaaccg atcacatcac aacgaaatat gaaggacaca accaaactga tagaggcaca caccagcata aaaaaccaca
acttattgaa ttctatttgt gatcctccag ccgaagtttg tgaaaagtta cataaccatt gactcaagat ggcgacatgc
aacttttatt aacttgatat cttcatcaca cttttgtagt ggaacctagg accggaccgg ccaatatgtt gcctgaaaag
cacctgcata taaaattcag atggtatttt atcaaaaact atatcattta tgctcaacta tagagtccaa cataaagtag
atgctcctac aagaatgagt ttttttggtt tttttatcaa ccctcacaag ccaatttcca aaaatatgag aaatactatg
aggaatatat aaaccagaag aaaactgcga tgctctccaa aggaattttg catagtgaca ctccaggaaa agatgatgga
tagtctcatt tttcatgcaa aagcaacatc tcatactacc attccaattc ctcttaccaa attgttcttt gtcaaaacca
ccccttttaa gttttaacaa gtaccacata aaaatcttaa tcttaagagg cattttaagt ttctagataa tcttCAAAAA
ATGTTTTTTT CTGTTCACTA AAAAATGTCC CCTTTTTTTT CTGTTTATAC TAAAAAAATT TTATTTCCGC AGTAAGTTGC
ACATGTATAG TGTCACAATG AATCATCTCC TATACAGGTA TTGGCCCAAC AACAAGAGCA GGATGTATGT ACTTGAGAAT
ACCGGTGAGT ACCTCATTTC ATTTTTTTCC TTTTTCTGTT AAACGTTATA GAACAATGTT CTTATATTCC TTCCCTCCTT
TTAAACACCA GGGGATTATG TCAGAACCCA TGATCTTCAA CTAGGAGACT CCATTGTGAT ATACAAAGAT GATGAGAATA
ACCGATTTGT AATCACCTTG TCTCATAATT ATTTAATCAC CCTACTCTTT TATGCTCATT ACATATGATA ATTTATAACT
TGTGAAGGTC ATCGGAGCAA AGAAGGCAGG TGATCAACAA GCTGCCACTG TGCCACAAGT TGACGAGCAT ATCTCTACCC
TCTTCCCCAT TTTTCCAATT GCACAAGTCG ATGACTATCT CTCTCCCATG GCACCACAAG TTGATATCTC TGCCTTCGTG
CCACATGCTG ATGAGAACCA TGAGATATTT GACGGGATAC TGAATTCTCT GCCAGAGATA CCAGTAGCCA ATGTGAGGTA
TTCTGACTTC TTCGACCCAT TCGATGATGG TATGGACATG GCAAACACTC TGAACGCCAA CGCCAACCAG TCTGCTAGTC
TGCATGTCAC TGATGATAAG TCTGGGCATT CCTTGATTCC CAACCCAAAG TCTGGGCCTC ACATGTGAGA CTGACAGGGA
AGTGGTATTT CATACCATGG TCAGTTTGTA TGAAGCTCAG AAACCCCTTC CCTGGCGCCA TTGTTGTACA TCCAAATAAT
TGGTGTCCTT ATTTTGACGC TGTATATGCT AACTGCTACA TGCAGTTTTA TGTGTAAAAT ATTTTGTTCA CAACCCAACT
GGAGGTTTAA TCAGATGAAA CATTGTAACT C