Os01t0718000-01

Locus

Os01g0718000

Description

Zinc finger, AN1-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SAP2

CGSNL Gene Name

STRESS ASSOCIATED PROTEIN GENE 2

Oryzabase Gene Symbol Synonym(s)

OsSAP2

Oryzabase Gene Name Synonym(s)

stress-associated protein 2

Transcript Evidence

AK111476 (DDBJ, Best hit)

Protein Evidence

Q942F8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, AN1-type (IPR000058)

Zinc finger, A20-type (IPR002653)

Full-length cDNA

002-185-A01 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0718000-01)

RiceXPro (AK111476)

Others

Oryzabase (18180)

KEGG (Os01t0718000-01)

Transcript

685 bp

>Os01t0718000-01 Zinc finger, AN1-type domain containing protein.
GCAGGCTTGCAGCTCTCAACCTCCTCGTCGACGCCGGGGAAGGGAAGCCTGCGTTCGGGC
GAGCGATGGAGCAGGGAAGCGAGAGGCAGGACGAGCGGCCGCCGCTCCCGTGCGCGAACG
GCTGCGGCTTCTTCGGCTCTGCCGACACCCGTGGCCTCTGCTCCAAGTGCTACCGCCAGA
CCGTGATGTCCCAGGCCTCCGCGCCGTCGGCCGCAGCACAGTCCGCGGAGCACGACCAGG
TGGTGTTGCCGGCGCCGGAGGGCGTACCCGTGGACGAGGGGGCGATGCCGCCGCCGCCGC
CGCGGCACGGGGCGAAGACGAAGAGCAGGTGCGCTGCGTGCGGGAGGAGCGTGGGGCTGA
TGGGGTTCGAGTGCCGCTGCGGTGCCGTGTTCTGCGGCGCGCATCGCTACTCGGACAGGC
ACGACTGCGGCTACGATTACAGGGGCGCCGGGCGCGACGCCATCGCCCGCGCCAACCCCG
TCGTGAGACCCGACAAGGTGGAGAAGCTCTGAAAAAAAAGGAAAAGCTACAACTGCTCGA
TCTTGCCAACATTGCCATGCCCGAACCAAACGATTGGTCGATTGCTGATTTGCTTCTCGT
GCGAGATGGAGTCGGTACTCGGTACTGATCTATGTATGGAGATATGATATATGTAGAGAT
TGGAAATTGATGATTCTGTGTGGCT

CDS

447 bp

>Os01t0718000-01 Zinc finger, AN1-type domain containing protein.
ATGGAGCAGGGAAGCGAGAGGCAGGACGAGCGGCCGCCGCTCCCGTGCGCGAACGGCTGC
GGCTTCTTCGGCTCTGCCGACACCCGTGGCCTCTGCTCCAAGTGCTACCGCCAGACCGTG
ATGTCCCAGGCCTCCGCGCCGTCGGCCGCAGCACAGTCCGCGGAGCACGACCAGGTGGTG
TTGCCGGCGCCGGAGGGCGTACCCGTGGACGAGGGGGCGATGCCGCCGCCGCCGCCGCGG
CACGGGGCGAAGACGAAGAGCAGGTGCGCTGCGTGCGGGAGGAGCGTGGGGCTGATGGGG
TTCGAGTGCCGCTGCGGTGCCGTGTTCTGCGGCGCGCATCGCTACTCGGACAGGCACGAC
TGCGGCTACGATTACAGGGGCGCCGGGCGCGACGCCATCGCCCGCGCCAACCCCGTCGTG
AGACCCGACAAGGTGGAGAAGCTCTGA

Protein

149 aa

>Os01t0718000-01 Zinc finger, AN1-type domain containing protein.
MEQGSERQDERPPLPCANGCGFFGSADTRGLCSKCYRQTVMSQASAPSAAAQSAEHDQVV
LPAPEGVPVDEGAMPPPPPRHGAKTKSRCAACGRSVGLMGFECRCGAVFCGAHRYSDRHD
CGYDYRGAGRDAIARANPVVRPDKVEKL*

5'UTR

chr01:29904726..29904790 (- strand) : 65 bp

CDS

chr01:29904279..29904725 (- strand) : 447 bp

3'UTR

chr01:29904106..29904278 (- strand) : 173 bp

FASTA

>Os01t0718000-01 class=Sequence position=chr01:29904106..29904790 (- strand)
GCAGGCTTGC AGCTCTCAAC CTCCTCGTCG ACGCCGGGGA AGGGAAGCCT GCGTTCGGGC GAGCGATGGA GCAGGGAAGC
GAGAGGCAGG ACGAGCGGCC GCCGCTCCCG TGCGCGAACG GCTGCGGCTT CTTCGGCTCT GCCGACACCC GTGGCCTCTG
CTCCAAGTGC TACCGCCAGA CCGTGATGTC CCAGGCCTCC GCGCCGTCGG CCGCAGCACA GTCCGCGGAG CACGACCAGG
TGGTGTTGCC GGCGCCGGAG GGCGTACCCG TGGACGAGGG GGCGATGCCG CCGCCGCCGC CGCGGCACGG GGCGAAGACG
AAGAGCAGGT GCGCTGCGTG CGGGAGGAGC GTGGGGCTGA TGGGGTTCGA GTGCCGCTGC GGTGCCGTGT TCTGCGGCGC
GCATCGCTAC TCGGACAGGC ACGACTGCGG CTACGATTAC AGGGGCGCCG GGCGCGACGC CATCGCCCGC GCCAACCCCG
TCGTGAGACC CGACAAGGTG GAGAAGCTCT GAAAAAAAAG GAAAAGCTAC AACTGCTCGA TCTTGCCAAC ATTGCCATGC
CCGAACCAAA CGATTGGTCG ATTGCTGATT TGCTTCTCGT GCGAGATGGA GTCGGTACTC GGTACTGATC TATGTATGGA
GATATGATAT ATGTAGAGAT TGGAAATTGA TGATTCTGTG TGGCT

Locus: Os01g0718000

Loading...

Locus: Os01g0718000

Loading...