Os01t0718300-01

Locus

Os01g0718300

Description

Receptor serine/threonine kinase, Organ development through controlling cell division and elongation

RAP-DB Gene Symbol Synonym(s)

D61, d61*, dwf42, d61, OsBRI1, OSBRI1, BRI1, Os BRI1, Osbri1

RAP-DB Gene Name Synonym(s)

DWARF 61, dm-type dwarf, dwarf-61, DWARF61, BRASSINOSTEROID INSENSITIVE 1, BR receptor BRASSINOSTEROID INSENSITIVE1, BRASSINOSTEROID-INSENSITIVE1, brassinosteroid insensitive 1

CGSNL Gene Symbol

D61

CGSNL Gene Name

DWARF 61

Oryzabase Gene Symbol Synonym(s)

d61*, dwf42, d61, OsBRI1, OSBRI1, BRI1, Os BRI1, Osbri1

Oryzabase Gene Name Synonym(s)

dm-type dwarf, dwarf-61, DWARF61, BRASSINOSTEROID INSENSITIVE 1, BR receptor BRASSINOSTEROID INSENSITIVE1, BRASSINOSTEROID-INSENSITIVE1, brassinosteroid insensitive 1

Transcript Evidence

AK101085

Protein Evidence

Q942F3

Literature

PMID: 11006334

PMID: 16407447

Note

Manual Curation

November 16, 2009

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Concanavalin A-like lectin/glucanase domain (IPR013320)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

Serine/threonine/dual specificity protein kinase, catalytic domain (IPR002290)

Leucine-rich repeat (IPR001611)

Leucine-rich repeat, typical subtype (IPR003591)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Full-length cDNA

J033024I12 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0718300-01)

RiceXPro (AK101085)

Others

Oryzabase (2018)

KEGG (Os01t0718300-01 (EC:2.7.1.37))

Transcript

3857 bp

>Os01t0718300-01 Receptor serine/threonine kinase, Organ development through controlling cell division and elongation
ATCTCCTCCTCATCACTTCCCACTCTCCCCCTTCTGTCTCTCTACTTTCTCTCTCTACCG
CCGCTCTCGCAGCAGGCCAGGTTCTCTCTAATGGTCGTGAGGCAGTGAGCTCGCTCGTAC
ATGGATTCCTTGTGGGCAGCGATAGCGGCACTGTTTGTGGCGGCGGCGGTGGTGGTGAGG
GGGGCGGCGGCGGCCGACGACGCCCAGCTGCTCGAGGAGTTCAGGCAGGCGGTGCCGAAC
CAGGCGGCGCTCAAGGGGTGGAGCGGCGGCGACGGCGCGTGCAGGTTCCCGGGGGCCGGG
TGCCGGAACGGGAGGCTCACGTCGCTGTCGCTCGCCGGCGTGCCGCTCAATGCCGAGTTC
CGCGCCGTCGCGGCCACCCTGCTGCAGCTCGGCAGCGTCGAGGTGCTGAGCCTCCGCGGC
GCCAACGTCAGCGGCGCGCTCTCGGCGGCTGGCGGCGCGAGGTGCGGGAGCAAGCTGCAG
GCGCTCGATTTGTCCGGGAATGCCGCGCTCCGGGGCTCCGTCGCCGACGTGGCGGCCCTG
GCCAGCGCCTGCGGCGGCCTCAAGACGCTGAATCTCTCCGGCGATGCGGTTGGTGCGGCG
AAGGTCGGTGGCGGTGGTGGCCCGGGCTTTGCCGGGCTGGACTCGCTTGATTTGTCCAAC
AACAAGATCACCGACGATAGCGACCTCCGGTGGATGGTGGATGCCGGAGTCGGGGCAGTA
CGGTGGTTGGACCTTGCCCTGAACAGGATCTCCGGTGTCCCGGAGTTCACCAACTGCTCC
GGGCTTCAGTACCTTGACCTCTCCGGCAACCTCATCGTCGGTGAGGTGCCCGGCGGGGCA
CTTTCCGACTGCCGCGGTCTGAAAGTGCTCAACCTCTCCTTCAACCACCTCGCCGGCGTG
TTCCCTCCGGACATCGCCGGCCTCACGTCGCTCAACGCCCTCAACCTCTCCAACAACAAC
TTCTCCGGCGAGCTCCCCGGCGAGGCTTTCGCAAAGCTGCAGCAGCTTACGGCGCTCTCC
CTCTCCTTCAACCACTTCAACGGCTCCATCCCGGACACCGTAGCCTCGCTGCCGGAgctc
cagcagctcgacctcagctccaacaccttctccggcaccatcccgtcgtccctctgccaa
gatcccaactccaagctccatctgctgtaccttcagaacaactacctcaccggcggcatc
ccagacgccgtctccaactgcaccagcctcGTCTCCCTCGACCTCAGCCTCAACTACATC
AATGGGTCCATCCCGGCATCCCTCGGCGACCTTGGCAACCTGCAGGACCTCATCCTGTGG
CAGAACGAGCTGGAGGGCGAGATACCGGCGTCCCTGTCGCGCATTCAGGGCCTCGAGCAT
CTCATCCTCGACTACAACGGGCTCACGGGTAGCATCCCGCCGGAGCTAGCCAAGTGCACC
AAGCTGAACTGGATTTCTTTGGCGAGCAACCGGCTGTCCGGGCCAATCCCTTCATGGCTT
GGGAAGCTCAGCTACTTGGCTATCTTGAAGCTCAGCAACAATTCCTTCTCGGGGCCTATA
CCGCCAGAGCTCGGTGACTGCCAGAGCTTGGTGTGGCTGGACCTGAATAGCAATCAGCTG
AATGGATCAATACCCAAAGAGCTGGCCAAACAGTCTGGGAAGATGAATGTTGGCCTCATA
GTTGGACGGCCTTACGTTTATCTTCGCAACGACGAGCTGAGCAGCGAGTGCCGTGGCAAG
GGGAGCTTGCTGGAGTTTACCAGCATCCGACCTGATGACCTCAGTCGGATGCCGAGCAAG
AAGCTGTGCAACTTCACAAGAATGTATGTGGGGAGCACGGAGTACACCTTCAACAAGAAT
GGTTCGATGATATTTCTCGATTTGTCATATAATCAGCTGGACTCGGCGATTCCTGGCGAG
CTGGGGGACATGTTCTACCTCATGATCATGAATCTTGGGCACAACCTACTGTCAGGTACC
ATCCCATCGCGGCTAGCAGAGGCCAAGAAGCTTGCGGTGCTTGACCTGTCGTATAACCAG
TTGGAAGGGCCAATACCCAACTCTTTCTCGGCACTTTCCTTGTCGGAGATCAATCTGTCA
AATAATCAGCTGAATGGAACAATTCCAGAGCTTGGTTCCCTTGCCACATTTCCGAAGAGC
CAGTATGAGAATAACACTGGTTTATGTGGCTTCCCACTGCCACCATGTGACCATAGTTCC
CCAAGATCTTCCAATGACCACCAATCCCACCGGAGGCAGGCATCGATGGCAAGCAGTATC
GCTATGGGACTGTTATTCTCACTGTTCTGTATAATTGTGATCATCATAGCCATTGGGAGC
AAGCGGCGGAGGCTGAAGAATGAGGAGGCGAGTACCTCTCGTGATATATATATTGATAGC
AGGTCACATTCTGCAACTATGAATTCTGATTGGAGGCAAAATCTCTCCGGTACAAATCTT
CTTAGCATCAACCTGGCTGCATTCGAGAAGCCATTGCAGAATCTCACCCTGGCTGATCTT
GTTGAGGCCACAAATGGCTTCCACATCGCATGCCAAATTGGGTCTGGTGGGTTTGGTGAT
GTCTACAAGGCACAGCTCAAGGATGGGAAGGTTGTTGCAATCAAGAAGCTAATACATGTG
AGCGGGCAGGGTGACCGGGAGTTCACTGCAGAAATGGAGACCATTGGCAAGATCAAACAC
CGTAACCTTGTTCCACTTCTTGGCTATTGCAAGGCTGGTGAGGAGCGGTTGTTGGTGTAT
GATTACATGAAGTTTGGCAGCTTGGAGGATGTGTTGCATGACCGCAAAAAGATCGGTAAA
AAGCTGAATTGGGAGGCAAGACGGAAAATCGCTGTTGGAGCAGCAAGGGGTTTGGCATTC
CTCCACCACAATTGCATTCCTCACATCATTCACCGAGACATGAAGTCGAGCAATGTGCTT
ATCGATGAACAACTGGAAGCAAGGGTATCTGATTTCGGTATGGCGAGGCTGATGAGCGTG
GTGGATACACACCTTAGCGTGTCCACTCTTGCTGGAACGCCAGGGTATGTACCACCGGAG
TACTACCAGAGCTTCAGATGCACCACCAAGGGTGATGTTTATAGCTATGGTGTTGTGTTG
CTGGAGCTGCTCACCGGGAAACCGCCGACGGACTCGGCAGACTTTGGCGAGGACAATAAC
CTTGTGGGGTGGGTCAAGCAGCACACCAAATTGAAGATCACGGATGTCTTCGACCCTGAG
CTACTCAAGGAGGATCCATCCGTCGAGCTTGAGCTGCTGGAGCATTTGAAAATCGCCTGT
GCGTGCTTGGATGACCGGCCGTCGAGGCGGCCGACGATGCTGAAGGTGATGGCAATGTTC
AAGGAGATCCAAGCTGGGTCGACGGTCGACTCGAAGACCTCGTCGGCGGCAGCGGGCTCG
ATCGATGAGGGAGGCTATGGGGTCCTTGACATGCCCCTCAGGGAAGCCAAGGAGGAGAAG
GATTAGAAACAACAACCACCGACACACAGGAGAAACAGCCGGCGGTGAGTGGCCACCAAC
GAGGCCAGTCGGCGGCGAAATGCCCGTAGAAACAACAGTCATTCAGAATCAGATGGATGC
CATTTTGAACTCTCCACACAAGCTTAGCAATCGCTTCTGATGGTGCTACAAGATAAGAAT
TTTCCAGCTGTAGGTTGATCAGTCGAAGTTGTTATGTACCTATAGGAGTAGATCTTTTCT
TCTTTCTTTTTTCGCAGCTTTCTTCGTCTCCCTGTTTGTTTTTCCCGTCGCGTCGCAGTA
AGAGCTGTGTATGTACATATATAAATGTTGAATTTTCTTTGGCGCAAAATCAAAATCCGC
CTAGGTTGCTCCTCGTC

CDS

3366 bp

>Os01t0718300-01 Receptor serine/threonine kinase, Organ development through controlling cell division and elongation
ATGGATTCCTTGTGGGCAGCGATAGCGGCACTGTTTGTGGCGGCGGCGGTGGTGGTGAGG
GGGGCGGCGGCGGCCGACGACGCCCAGCTGCTCGAGGAGTTCAGGCAGGCGGTGCCGAAC
CAGGCGGCGCTCAAGGGGTGGAGCGGCGGCGACGGCGCGTGCAGGTTCCCGGGGGCCGGG
TGCCGGAACGGGAGGCTCACGTCGCTGTCGCTCGCCGGCGTGCCGCTCAATGCCGAGTTC
CGCGCCGTCGCGGCCACCCTGCTGCAGCTCGGCAGCGTCGAGGTGCTGAGCCTCCGCGGC
GCCAACGTCAGCGGCGCGCTCTCGGCGGCTGGCGGCGCGAGGTGCGGGAGCAAGCTGCAG
GCGCTCGATTTGTCCGGGAATGCCGCGCTCCGGGGCTCCGTCGCCGACGTGGCGGCCCTG
GCCAGCGCCTGCGGCGGCCTCAAGACGCTGAATCTCTCCGGCGATGCGGTTGGTGCGGCG
AAGGTCGGTGGCGGTGGTGGCCCGGGCTTTGCCGGGCTGGACTCGCTTGATTTGTCCAAC
AACAAGATCACCGACGATAGCGACCTCCGGTGGATGGTGGATGCCGGAGTCGGGGCAGTA
CGGTGGTTGGACCTTGCCCTGAACAGGATCTCCGGTGTCCCGGAGTTCACCAACTGCTCC
GGGCTTCAGTACCTTGACCTCTCCGGCAACCTCATCGTCGGTGAGGTGCCCGGCGGGGCA
CTTTCCGACTGCCGCGGTCTGAAAGTGCTCAACCTCTCCTTCAACCACCTCGCCGGCGTG
TTCCCTCCGGACATCGCCGGCCTCACGTCGCTCAACGCCCTCAACCTCTCCAACAACAAC
TTCTCCGGCGAGCTCCCCGGCGAGGCTTTCGCAAAGCTGCAGCAGCTTACGGCGCTCTCC
CTCTCCTTCAACCACTTCAACGGCTCCATCCCGGACACCGTAGCCTCGCTGCCGGAgctc
cagcagctcgacctcagctccaacaccttctccggcaccatcccgtcgtccctctgccaa
gatcccaactccaagctccatctgctgtaccttcagaacaactacctcaccggcggcatc
ccagacgccgtctccaactgcaccagcctcGTCTCCCTCGACCTCAGCCTCAACTACATC
AATGGGTCCATCCCGGCATCCCTCGGCGACCTTGGCAACCTGCAGGACCTCATCCTGTGG
CAGAACGAGCTGGAGGGCGAGATACCGGCGTCCCTGTCGCGCATTCAGGGCCTCGAGCAT
CTCATCCTCGACTACAACGGGCTCACGGGTAGCATCCCGCCGGAGCTAGCCAAGTGCACC
AAGCTGAACTGGATTTCTTTGGCGAGCAACCGGCTGTCCGGGCCAATCCCTTCATGGCTT
GGGAAGCTCAGCTACTTGGCTATCTTGAAGCTCAGCAACAATTCCTTCTCGGGGCCTATA
CCGCCAGAGCTCGGTGACTGCCAGAGCTTGGTGTGGCTGGACCTGAATAGCAATCAGCTG
AATGGATCAATACCCAAAGAGCTGGCCAAACAGTCTGGGAAGATGAATGTTGGCCTCATA
GTTGGACGGCCTTACGTTTATCTTCGCAACGACGAGCTGAGCAGCGAGTGCCGTGGCAAG
GGGAGCTTGCTGGAGTTTACCAGCATCCGACCTGATGACCTCAGTCGGATGCCGAGCAAG
AAGCTGTGCAACTTCACAAGAATGTATGTGGGGAGCACGGAGTACACCTTCAACAAGAAT
GGTTCGATGATATTTCTCGATTTGTCATATAATCAGCTGGACTCGGCGATTCCTGGCGAG
CTGGGGGACATGTTCTACCTCATGATCATGAATCTTGGGCACAACCTACTGTCAGGTACC
ATCCCATCGCGGCTAGCAGAGGCCAAGAAGCTTGCGGTGCTTGACCTGTCGTATAACCAG
TTGGAAGGGCCAATACCCAACTCTTTCTCGGCACTTTCCTTGTCGGAGATCAATCTGTCA
AATAATCAGCTGAATGGAACAATTCCAGAGCTTGGTTCCCTTGCCACATTTCCGAAGAGC
CAGTATGAGAATAACACTGGTTTATGTGGCTTCCCACTGCCACCATGTGACCATAGTTCC
CCAAGATCTTCCAATGACCACCAATCCCACCGGAGGCAGGCATCGATGGCAAGCAGTATC
GCTATGGGACTGTTATTCTCACTGTTCTGTATAATTGTGATCATCATAGCCATTGGGAGC
AAGCGGCGGAGGCTGAAGAATGAGGAGGCGAGTACCTCTCGTGATATATATATTGATAGC
AGGTCACATTCTGCAACTATGAATTCTGATTGGAGGCAAAATCTCTCCGGTACAAATCTT
CTTAGCATCAACCTGGCTGCATTCGAGAAGCCATTGCAGAATCTCACCCTGGCTGATCTT
GTTGAGGCCACAAATGGCTTCCACATCGCATGCCAAATTGGGTCTGGTGGGTTTGGTGAT
GTCTACAAGGCACAGCTCAAGGATGGGAAGGTTGTTGCAATCAAGAAGCTAATACATGTG
AGCGGGCAGGGTGACCGGGAGTTCACTGCAGAAATGGAGACCATTGGCAAGATCAAACAC
CGTAACCTTGTTCCACTTCTTGGCTATTGCAAGGCTGGTGAGGAGCGGTTGTTGGTGTAT
GATTACATGAAGTTTGGCAGCTTGGAGGATGTGTTGCATGACCGCAAAAAGATCGGTAAA
AAGCTGAATTGGGAGGCAAGACGGAAAATCGCTGTTGGAGCAGCAAGGGGTTTGGCATTC
CTCCACCACAATTGCATTCCTCACATCATTCACCGAGACATGAAGTCGAGCAATGTGCTT
ATCGATGAACAACTGGAAGCAAGGGTATCTGATTTCGGTATGGCGAGGCTGATGAGCGTG
GTGGATACACACCTTAGCGTGTCCACTCTTGCTGGAACGCCAGGGTATGTACCACCGGAG
TACTACCAGAGCTTCAGATGCACCACCAAGGGTGATGTTTATAGCTATGGTGTTGTGTTG
CTGGAGCTGCTCACCGGGAAACCGCCGACGGACTCGGCAGACTTTGGCGAGGACAATAAC
CTTGTGGGGTGGGTCAAGCAGCACACCAAATTGAAGATCACGGATGTCTTCGACCCTGAG
CTACTCAAGGAGGATCCATCCGTCGAGCTTGAGCTGCTGGAGCATTTGAAAATCGCCTGT
GCGTGCTTGGATGACCGGCCGTCGAGGCGGCCGACGATGCTGAAGGTGATGGCAATGTTC
AAGGAGATCCAAGCTGGGTCGACGGTCGACTCGAAGACCTCGTCGGCGGCAGCGGGCTCG
ATCGATGAGGGAGGCTATGGGGTCCTTGACATGCCCCTCAGGGAAGCCAAGGAGGAGAAG
GATTAG

Protein

1122 aa

>Os01t0718300-01 Receptor serine/threonine kinase, Organ development through controlling cell division and elongation
MDSLWAAIAALFVAAAVVVRGAAAADDAQLLEEFRQAVPNQAALKGWSGGDGACRFPGAG
CRNGRLTSLSLAGVPLNAEFRAVAATLLQLGSVEVLSLRGANVSGALSAAGGARCGSKLQ
ALDLSGNAALRGSVADVAALASACGGLKTLNLSGDAVGAAKVGGGGGPGFAGLDSLDLSN
NKITDDSDLRWMVDAGVGAVRWLDLALNRISGVPEFTNCSGLQYLDLSGNLIVGEVPGGA
LSDCRGLKVLNLSFNHLAGVFPPDIAGLTSLNALNLSNNNFSGELPGEAFAKLQQLTALS
LSFNHFNGSIPDTVASLPELQQLDLSSNTFSGTIPSSLCQDPNSKLHLLYLQNNYLTGGI
PDAVSNCTSLVSLDLSLNYINGSIPASLGDLGNLQDLILWQNELEGEIPASLSRIQGLEH
LILDYNGLTGSIPPELAKCTKLNWISLASNRLSGPIPSWLGKLSYLAILKLSNNSFSGPI
PPELGDCQSLVWLDLNSNQLNGSIPKELAKQSGKMNVGLIVGRPYVYLRNDELSSECRGK
GSLLEFTSIRPDDLSRMPSKKLCNFTRMYVGSTEYTFNKNGSMIFLDLSYNQLDSAIPGE
LGDMFYLMIMNLGHNLLSGTIPSRLAEAKKLAVLDLSYNQLEGPIPNSFSALSLSEINLS
NNQLNGTIPELGSLATFPKSQYENNTGLCGFPLPPCDHSSPRSSNDHQSHRRQASMASSI
AMGLLFSLFCIIVIIIAIGSKRRRLKNEEASTSRDIYIDSRSHSATMNSDWRQNLSGTNL
LSINLAAFEKPLQNLTLADLVEATNGFHIACQIGSGGFGDVYKAQLKDGKVVAIKKLIHV
SGQGDREFTAEMETIGKIKHRNLVPLLGYCKAGEERLLVYDYMKFGSLEDVLHDRKKIGK
KLNWEARRKIAVGAARGLAFLHHNCIPHIIHRDMKSSNVLIDEQLEARVSDFGMARLMSV
VDTHLSVSTLAGTPGYVPPEYYQSFRCTTKGDVYSYGVVLLELLTGKPPTDSADFGEDNN
LVGWVKQHTKLKITDVFDPELLKEDPSVELELLEHLKIACACLDDRPSRRPTMLKVMAMF
KEIQAGSTVDSKTSSAAAGSIDEGGYGVLDMPLREAKEEKD*

5'UTR

chr01:29931333..29931452 (- strand) : 120 bp

CDS

chr01:29927967..29931332 (- strand) : 3366 bp

3'UTR

chr01:29927596..29927966 (- strand) : 371 bp

FASTA

>Os01t0718300-01 class=Sequence position=chr01:29927596..29931452 (- strand)
ATCTCCTCCT CATCACTTCC CACTCTCCCC CTTCTGTCTC TCTACTTTCT CTCTCTACCG CCGCTCTCGC AGCAGGCCAG
GTTCTCTCTA ATGGTCGTGA GGCAGTGAGC TCGCTCGTAC ATGGATTCCT TGTGGGCAGC GATAGCGGCA CTGTTTGTGG
CGGCGGCGGT GGTGGTGAGG GGGGCGGCGG CGGCCGACGA CGCCCAGCTG CTCGAGGAGT TCAGGCAGGC GGTGCCGAAC
CAGGCGGCGC TCAAGGGGTG GAGCGGCGGC GACGGCGCGT GCAGGTTCCC GGGGGCCGGG TGCCGGAACG GGAGGCTCAC
GTCGCTGTCG CTCGCCGGCG TGCCGCTCAA TGCCGAGTTC CGCGCCGTCG CGGCCACCCT GCTGCAGCTC GGCAGCGTCG
AGGTGCTGAG CCTCCGCGGC GCCAACGTCA GCGGCGCGCT CTCGGCGGCT GGCGGCGCGA GGTGCGGGAG CAAGCTGCAG
GCGCTCGATT TGTCCGGGAA TGCCGCGCTC CGGGGCTCCG TCGCCGACGT GGCGGCCCTG GCCAGCGCCT GCGGCGGCCT
CAAGACGCTG AATCTCTCCG GCGATGCGGT TGGTGCGGCG AAGGTCGGTG GCGGTGGTGG CCCGGGCTTT GCCGGGCTGG
ACTCGCTTGA TTTGTCCAAC AACAAGATCA CCGACGATAG CGACCTCCGG TGGATGGTGG ATGCCGGAGT CGGGGCAGTA
CGGTGGTTGG ACCTTGCCCT GAACAGGATC TCCGGTGTCC CGGAGTTCAC CAACTGCTCC GGGCTTCAGT ACCTTGACCT
CTCCGGCAAC CTCATCGTCG GTGAGGTGCC CGGCGGGGCA CTTTCCGACT GCCGCGGTCT GAAAGTGCTC AACCTCTCCT
TCAACCACCT CGCCGGCGTG TTCCCTCCGG ACATCGCCGG CCTCACGTCG CTCAACGCCC TCAACCTCTC CAACAACAAC
TTCTCCGGCG AGCTCCCCGG CGAGGCTTTC GCAAAGCTGC AGCAGCTTAC GGCGCTCTCC CTCTCCTTCA ACCACTTCAA
CGGCTCCATC CCGGACACCG TAGCCTCGCT GCCGGAgctc cagcagctcg acctcagctc caacaccttc tccggcacca
tcccgtcgtc cctctgccaa gatcccaact ccaagctcca tctgctgtac cttcagaaca actacctcac cggcggcatc
ccagacgccg tctccaactg caccagcctc GTCTCCCTCG ACCTCAGCCT CAACTACATC AATGGGTCCA TCCCGGCATC
CCTCGGCGAC CTTGGCAACC TGCAGGACCT CATCCTGTGG CAGAACGAGC TGGAGGGCGA GATACCGGCG TCCCTGTCGC
GCATTCAGGG CCTCGAGCAT CTCATCCTCG ACTACAACGG GCTCACGGGT AGCATCCCGC CGGAGCTAGC CAAGTGCACC
AAGCTGAACT GGATTTCTTT GGCGAGCAAC CGGCTGTCCG GGCCAATCCC TTCATGGCTT GGGAAGCTCA GCTACTTGGC
TATCTTGAAG CTCAGCAACA ATTCCTTCTC GGGGCCTATA CCGCCAGAGC TCGGTGACTG CCAGAGCTTG GTGTGGCTGG
ACCTGAATAG CAATCAGCTG AATGGATCAA TACCCAAAGA GCTGGCCAAA CAGTCTGGGA AGATGAATGT TGGCCTCATA
GTTGGACGGC CTTACGTTTA TCTTCGCAAC GACGAGCTGA GCAGCGAGTG CCGTGGCAAG GGGAGCTTGC TGGAGTTTAC
CAGCATCCGA CCTGATGACC TCAGTCGGAT GCCGAGCAAG AAGCTGTGCA ACTTCACAAG AATGTATGTG GGGAGCACGG
AGTACACCTT CAACAAGAAT GGTTCGATGA TATTTCTCGA TTTGTCATAT AATCAGCTGG ACTCGGCGAT TCCTGGCGAG
CTGGGGGACA TGTTCTACCT CATGATCATG AATCTTGGGC ACAACCTACT GTCAGGTACC ATCCCATCGC GGCTAGCAGA
GGCCAAGAAG CTTGCGGTGC TTGACCTGTC GTATAACCAG TTGGAAGGGC CAATACCCAA CTCTTTCTCG GCACTTTCCT
TGTCGGAGAT CAATCTGTCA AATAATCAGC TGAATGGAAC AATTCCAGAG CTTGGTTCCC TTGCCACATT TCCGAAGAGC
CAGTATGAGA ATAACACTGG TTTATGTGGC TTCCCACTGC CACCATGTGA CCATAGTTCC CCAAGATCTT CCAATGACCA
CCAATCCCAC CGGAGGCAGG CATCGATGGC AAGCAGTATC GCTATGGGAC TGTTATTCTC ACTGTTCTGT ATAATTGTGA
TCATCATAGC CATTGGGAGC AAGCGGCGGA GGCTGAAGAA TGAGGAGGCG AGTACCTCTC GTGATATATA TATTGATAGC
AGGTCACATT CTGCAACTAT GAATTCTGAT TGGAGGCAAA ATCTCTCCGG TACAAATCTT CTTAGCATCA ACCTGGCTGC
ATTCGAGAAG CCATTGCAGA ATCTCACCCT GGCTGATCTT GTTGAGGCCA CAAATGGCTT CCACATCGCA TGCCAAATTG
GGTCTGGTGG GTTTGGTGAT GTCTACAAGG CACAGCTCAA GGATGGGAAG GTTGTTGCAA TCAAGAAGCT AATACATGTG
AGCGGGCAGG GTGACCGGGA GTTCACTGCA GAAATGGAGA CCATTGGCAA GATCAAACAC CGTAACCTTG TTCCACTTCT
TGGCTATTGC AAGGCTGGTG AGGAGCGGTT GTTGGTGTAT GATTACATGA AGTTTGGCAG CTTGGAGGAT GTGTTGCATG
ACCGCAAAAA GATCGGTAAA AAGCTGAATT GGGAGGCAAG ACGGAAAATC GCTGTTGGAG CAGCAAGGGG TTTGGCATTC
CTCCACCACA ATTGCATTCC TCACATCATT CACCGAGACA TGAAGTCGAG CAATGTGCTT ATCGATGAAC AACTGGAAGC
AAGGGTATCT GATTTCGGTA TGGCGAGGCT GATGAGCGTG GTGGATACAC ACCTTAGCGT GTCCACTCTT GCTGGAACGC
CAGGGTATGT ACCACCGGAG TACTACCAGA GCTTCAGATG CACCACCAAG GGTGATGTTT ATAGCTATGG TGTTGTGTTG
CTGGAGCTGC TCACCGGGAA ACCGCCGACG GACTCGGCAG ACTTTGGCGA GGACAATAAC CTTGTGGGGT GGGTCAAGCA
GCACACCAAA TTGAAGATCA CGGATGTCTT CGACCCTGAG CTACTCAAGG AGGATCCATC CGTCGAGCTT GAGCTGCTGG
AGCATTTGAA AATCGCCTGT GCGTGCTTGG ATGACCGGCC GTCGAGGCGG CCGACGATGC TGAAGGTGAT GGCAATGTTC
AAGGAGATCC AAGCTGGGTC GACGGTCGAC TCGAAGACCT CGTCGGCGGC AGCGGGCTCG ATCGATGAGG GAGGCTATGG
GGTCCTTGAC ATGCCCCTCA GGGAAGCCAA GGAGGAGAAG GATTAGAAAC AACAACCACC GACACACAGG AGAAACAGCC
GGCGGTGAGT GGCCACCAAC GAGGCCAGTC GGCGGCGAAA TGCCCGTAGA AACAACAGTC ATTCAGAATC AGATGGATGC
CATTTTGAAC TCTCCACACA AGCTTAGCAA TCGCTTCTGA TGGTGCTACA AGATAAGAAT TTTCCAGCTG TAGGTTGATC
AGTCGAAGTT GTTATGTACC TATAGGAGTA GATCTTTTCT TCTTTCTTTT TTCGCAGCTT TCTTCGTCTC CCTGTTTGTT
TTTCCCGTCG CGTCGCAGTA AGAGCTGTGT ATGTACATAT ATAAATGTTG AATTTTCTTT GGCGCAAAAT CAAAATCCGC
CTAGGTTGCT CCTCGTC