Os01t0718300-02

Locus

Os01g0718300

Description

Similar to Systemin receptor SR160 precursor (EC 2.7.1.37) (Brassinosteroid LRR receptor kinase).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

D61

CGSNL Gene Name

DWARF 61

Oryzabase Gene Symbol Synonym(s)

d61*, dwf42, d61, OsBRI1, OSBRI1, BRI1, Os BRI1, Osbri1

Oryzabase Gene Name Synonym(s)

dm-type dwarf, dwarf-61, DWARF61, BRASSINOSTEROID INSENSITIVE 1, BR receptor BRASSINOSTEROID INSENSITIVE1, BRASSINOSTEROID-INSENSITIVE1, brassinosteroid insensitive 1

Transcript Evidence

AK073838 (DDBJ, Best hit)

Protein Evidence

B9EZ61 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Leucine-rich repeat (IPR001611)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

J033069J12 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0718300-02)

RiceXPro (AK073838)

Others

Oryzabase (2018)

KEGG (Os01t0718300-02 (EC:2.7.1.37))

Transcript

3782 bp

>Os01t0718300-02 Similar to Systemin receptor SR160 precursor (EC 2.7.1.37) (Brassinosteroid LRR receptor kinase).
ACTTTCTCTCTCTACCGCCGCTCTCGCAGCAGGCCAGGTTCTCTCTAATGGTCGTGAGGC
AGTGAGCTCGCTCGTACATGGATTCCTTGTGGGCAGCGATAGCGGCACTGTTTGTGGCGG
CGGCGGTGGTGGTGAGGGGGGCGGCGGCGGCCGACGACGCCCAGCTGCTCGAGGAGTTCA
GGCAGGCGGTGCCGAACCAGGCGGCGCTCAAGGGGTGGAGCGGCGGCGACGGCGCGTGCA
GGTTCCCGGGGGCCGGGTGCCGGAACGGGAGGCTCACGTCGCTGTCGCTCGCCGGCGTGC
CGCTCAATGCCGAGTTCCGCGCCGTCGCGGCCACCCTGCTGCAGCTCGGCAGCGTCGAGG
TGCTGAGCCTCCGCGGCGCCAACGTCAGCGGCGCGCTCTCGGCGGCTGGCGGCGCGAGGT
GCGGGAGCAAGCTGCAGGCGCTCGATTTGTCCGGGAATGCCGCGCTCCGGGGCTCCGTCG
CCGACGTGGCGGCCCTGGCCAGCGCCTGCGGCGGCCTCAAGACGCTGAATCTCTCCGGCG
ATGCGGTTGGTGCGGCGAAGGTCGGTGGCGGTGGTGGCCCGGGCTTTGCCGGGCTGGACT
CGCTTGATTTGTCCAACAACAAGATCACCGACGATAGCGACCTCCGGTGGATGGTGGATG
CCGGAGTCGGGGCAGTACGGTGGTTGGACCTTGCCCTGAACAGGATCTCCGGTGTCCCGG
AGTTCACCAACTGCTCCGGGCTTCAGTACCTTGACCTCTCCGGCAACCTCATCGTCGGTG
AGGTGCCCGGCGGGGCACTTTCCGACTGCCGCGGTCTGAAAGTGCTCAACCTCTCCTTCA
ACCACCTCGCCGGCGTGTTCCCTCCGGACATCGCCGGCCTCACGTCGCTCAACGCCCTCA
ACCTCTCCAACAACAACTTCTCCGGCGAGCTCCCCGGCGAGGCTTTCGCAAAGCTGCAGC
AGCTTACGGCGCTCTCCCTCTCCTTCAACCACTTCAACGGCTCCATCCCGGACACCGTAG
CCTCGCTGCCGGAgctccagcagctcgacctcagctccaacaccttctccggcaccatcc
cgtcgtccctctgccaagatcccaactccaagctccatctgctgtaccttcagaacaact
acctcaccggcggcatcccagacgccgtctccaactgcaccagcctcGTCTCCCTCGACC
TCAGCCTCAACTACATCAATGGGTCCATCCCGGCATCCCTCGGCGACCTTGGCAACCTGC
AGGACCTCATCCTGTGGCAGAACGAGCTGGAGGGCGAGATACCGGCGTCCCTGTCGCGCA
TTCAGGGCCTCGAGCATCTCATCCTCGACTACAACGGGCTCACGGGTAGCATCCCGCCGG
AGCTAGCCAAGTGCACCAAGCTGAACTGGATTTCTTTGGCGAGCAACCGGCTGTCCGGGC
CAATCCCTTCATGGCTTGGGAAGCTCAGCTACTTGGCTATCTTGAAGCTCAGCAACAATT
CCTTCTCGGGGCCTATACCGCCAGAGCTCGGTGACTGCCAGAGCTTGGTGTGGCTGGACC
TGAATAGCAATCAGCTGAATGGATCAATACCCAAAGAGCTGGCCAAACAGTCTGGGAAGA
TGAATGTTGGCCTCATAGTTGGACGGCCTTACGTTTATCTTCGCAACGACGAGCTGAGCA
GCGAGTGCCGTGGCAAGGGGAGCTTGCTGGAGTTTACCAGCATCCGACCTGATGACCTCA
GTCGGATGCCGAGCAAGAAGCTGTGCAACTTCACAAGAATGTATGTGGGGAGCACGGAGT
ACACCTTCAACAAGAATGGTTCGATGATATTTCTCGATTTGTCATATAATCAGCTGGACT
CGGCGATTCCTGGCGAGCTGGGGGACATGTTCTACCTCATGATCATGAATCTTGGGCACA
ACCTACTGTCAGGTACCATCCCATCGCGGCTAGCAGAGGCCAAGAAGCTTGCGGTGCTTG
ACCTGTCGTATAACCAGTTGGAAGGGCCAATACCCAACTCTTTCTCGGCACTTTCCTTGT
CGGAGATCAATCTGTCAAATAATCAGCTGAATGGAACAATTCCAGAGCTTGGTTCCCTTG
CCACATTTCCGAAGAGCCAGTATGAGAATAACACTGGTTTATGTGGCTTCCCACTGCCAC
CATGTGACCATAGTTCCCCAAGATCTTCCAATGACCACCAATCCCACCGGAGGCAGGCAT
CGATGGCAAGCAGTATCGCTATGGGACTGTTATTCTCACTGTTCTGTATAATTGTGATCA
TCATAGCCATTGGGAGCAAGCGGCGGAGGCTGAAGAATGAGGAGGCGAGTACCTCTCGTG
ATATATATATTGATAGCAGGTCACATTCTGCAACTATGAATTCTGATTGGAGGCAAAATC
TCTCCGGTACAAATCTTCTTAGCATCAACCTGGCTGCATTCGAGAAGCCATTGCAGAATC
TCACCCTGGCTGATCTTGTTGAGGCCACAAATGGCTTCCACATCGCATGCCAAATTGGGT
CTGGTGGGTTTGGTGATGTCTACAAGGCACAGCTCAAGGATGGGAAGGTTGTTGCAATCA
AGAAGCTAATACATGTGAGCGGGCAGGGTGACCGGGAGTTCACTGCAGAAATGGAGACCA
TTGGCAAGATCAAACACCGTAACCTTGTTCCACTTCTTGGCTATTGCAAGGCTGGTGAGG
AGCGGTTGTTGGTGTATGATTACATGAAGTTTGGCAGCTTGGAGGATGTGTTGCATGACC
GCAAAAAGATCGGTAAAAAGCTGAATTGGGAGGCAAGACGGAAAATCGCTGTTGGAGCAG
CAAGGGGTTTGGCATTCCTCCACCACAATTGCATTCCTCACATCATTCACCGAGACATGA
AGTCGAGCAATGTGCTTATCGATGAACAACTGGAAGCAAGGGTATCTGATTTCGGTATGG
CGAGGCTGATGAGCGTGGTGGATACACACCTTAGCGTGTCCACTCTTGCTGGAACGCCAG
GGTATGTACCACCGGAGTACTACCAGAGCTTCAGATGCACCACCAAGGGTGATGTTTATA
GCTATGGTGTTGTGTTGCTGGAGCTGCTCACCGGGAAACCGCCGACGGACTCGGCAGACT
TTGGCGAGGACAATAACCTTGTGGGGTGGGTCAAGCAGCACACCAAATTGAAGATCACGG
ATGTCTTCGACCCTGAGCTACTCAAGGAGGATCCATCCGTCGAGCTTGAGCTGCTGGAGC
ATTTGAAAATCGCCTGTGCGTGCTTGGATGACCGGCCGTCGAGGCGGCCGACGATGCTGA
AGGTGATGGCAATGTTCAAGGAGATCCAAGCTGGGTCGACGGTCGACTCGAAGACCTCGT
CGGCGGCAGCGGGCTCGATCGATGAGGGAGGCTATGGGGTCCTTGACATGCCCCTCAGGG
AAGCCAAGGAGGAGAAGGATTAGAAACAACAACCACCGACACACAGGAGAAACAGCCGGC
GGTGAGTGGCCACCAACGAGGCCAGTCGGCGGCGAAATGCCCGTAGAAACAACAGTCATT
CAGAATCAGATGGATGCCATTTTGAACTCTCCACACAAGCTTAGCAATCGCTTCTGATGG
TGCTACAAGATAAGAATTTTCCAGCTGTAGGTTGATCAGTCGAAGTTGTTATGTACCTAT
AGGAGTAGATCTTTTCTTCTTTCTTTTTTCGCAGCTTTCTTCGTCTCCCTGTTTGTTTTT
CCCGTCGCGTCGCAGTAAGAGCTGTGTATGTACATATATAAATGTTGAATTTTCTTTGGC
GC

CDS

3366 bp

>Os01t0718300-02 Similar to Systemin receptor SR160 precursor (EC 2.7.1.37) (Brassinosteroid LRR receptor kinase).
ATGGATTCCTTGTGGGCAGCGATAGCGGCACTGTTTGTGGCGGCGGCGGTGGTGGTGAGG
GGGGCGGCGGCGGCCGACGACGCCCAGCTGCTCGAGGAGTTCAGGCAGGCGGTGCCGAAC
CAGGCGGCGCTCAAGGGGTGGAGCGGCGGCGACGGCGCGTGCAGGTTCCCGGGGGCCGGG
TGCCGGAACGGGAGGCTCACGTCGCTGTCGCTCGCCGGCGTGCCGCTCAATGCCGAGTTC
CGCGCCGTCGCGGCCACCCTGCTGCAGCTCGGCAGCGTCGAGGTGCTGAGCCTCCGCGGC
GCCAACGTCAGCGGCGCGCTCTCGGCGGCTGGCGGCGCGAGGTGCGGGAGCAAGCTGCAG
GCGCTCGATTTGTCCGGGAATGCCGCGCTCCGGGGCTCCGTCGCCGACGTGGCGGCCCTG
GCCAGCGCCTGCGGCGGCCTCAAGACGCTGAATCTCTCCGGCGATGCGGTTGGTGCGGCG
AAGGTCGGTGGCGGTGGTGGCCCGGGCTTTGCCGGGCTGGACTCGCTTGATTTGTCCAAC
AACAAGATCACCGACGATAGCGACCTCCGGTGGATGGTGGATGCCGGAGTCGGGGCAGTA
CGGTGGTTGGACCTTGCCCTGAACAGGATCTCCGGTGTCCCGGAGTTCACCAACTGCTCC
GGGCTTCAGTACCTTGACCTCTCCGGCAACCTCATCGTCGGTGAGGTGCCCGGCGGGGCA
CTTTCCGACTGCCGCGGTCTGAAAGTGCTCAACCTCTCCTTCAACCACCTCGCCGGCGTG
TTCCCTCCGGACATCGCCGGCCTCACGTCGCTCAACGCCCTCAACCTCTCCAACAACAAC
TTCTCCGGCGAGCTCCCCGGCGAGGCTTTCGCAAAGCTGCAGCAGCTTACGGCGCTCTCC
CTCTCCTTCAACCACTTCAACGGCTCCATCCCGGACACCGTAGCCTCGCTGCCGGAgctc
cagcagctcgacctcagctccaacaccttctccggcaccatcccgtcgtccctctgccaa
gatcccaactccaagctccatctgctgtaccttcagaacaactacctcaccggcggcatc
ccagacgccgtctccaactgcaccagcctcGTCTCCCTCGACCTCAGCCTCAACTACATC
AATGGGTCCATCCCGGCATCCCTCGGCGACCTTGGCAACCTGCAGGACCTCATCCTGTGG
CAGAACGAGCTGGAGGGCGAGATACCGGCGTCCCTGTCGCGCATTCAGGGCCTCGAGCAT
CTCATCCTCGACTACAACGGGCTCACGGGTAGCATCCCGCCGGAGCTAGCCAAGTGCACC
AAGCTGAACTGGATTTCTTTGGCGAGCAACCGGCTGTCCGGGCCAATCCCTTCATGGCTT
GGGAAGCTCAGCTACTTGGCTATCTTGAAGCTCAGCAACAATTCCTTCTCGGGGCCTATA
CCGCCAGAGCTCGGTGACTGCCAGAGCTTGGTGTGGCTGGACCTGAATAGCAATCAGCTG
AATGGATCAATACCCAAAGAGCTGGCCAAACAGTCTGGGAAGATGAATGTTGGCCTCATA
GTTGGACGGCCTTACGTTTATCTTCGCAACGACGAGCTGAGCAGCGAGTGCCGTGGCAAG
GGGAGCTTGCTGGAGTTTACCAGCATCCGACCTGATGACCTCAGTCGGATGCCGAGCAAG
AAGCTGTGCAACTTCACAAGAATGTATGTGGGGAGCACGGAGTACACCTTCAACAAGAAT
GGTTCGATGATATTTCTCGATTTGTCATATAATCAGCTGGACTCGGCGATTCCTGGCGAG
CTGGGGGACATGTTCTACCTCATGATCATGAATCTTGGGCACAACCTACTGTCAGGTACC
ATCCCATCGCGGCTAGCAGAGGCCAAGAAGCTTGCGGTGCTTGACCTGTCGTATAACCAG
TTGGAAGGGCCAATACCCAACTCTTTCTCGGCACTTTCCTTGTCGGAGATCAATCTGTCA
AATAATCAGCTGAATGGAACAATTCCAGAGCTTGGTTCCCTTGCCACATTTCCGAAGAGC
CAGTATGAGAATAACACTGGTTTATGTGGCTTCCCACTGCCACCATGTGACCATAGTTCC
CCAAGATCTTCCAATGACCACCAATCCCACCGGAGGCAGGCATCGATGGCAAGCAGTATC
GCTATGGGACTGTTATTCTCACTGTTCTGTATAATTGTGATCATCATAGCCATTGGGAGC
AAGCGGCGGAGGCTGAAGAATGAGGAGGCGAGTACCTCTCGTGATATATATATTGATAGC
AGGTCACATTCTGCAACTATGAATTCTGATTGGAGGCAAAATCTCTCCGGTACAAATCTT
CTTAGCATCAACCTGGCTGCATTCGAGAAGCCATTGCAGAATCTCACCCTGGCTGATCTT
GTTGAGGCCACAAATGGCTTCCACATCGCATGCCAAATTGGGTCTGGTGGGTTTGGTGAT
GTCTACAAGGCACAGCTCAAGGATGGGAAGGTTGTTGCAATCAAGAAGCTAATACATGTG
AGCGGGCAGGGTGACCGGGAGTTCACTGCAGAAATGGAGACCATTGGCAAGATCAAACAC
CGTAACCTTGTTCCACTTCTTGGCTATTGCAAGGCTGGTGAGGAGCGGTTGTTGGTGTAT
GATTACATGAAGTTTGGCAGCTTGGAGGATGTGTTGCATGACCGCAAAAAGATCGGTAAA
AAGCTGAATTGGGAGGCAAGACGGAAAATCGCTGTTGGAGCAGCAAGGGGTTTGGCATTC
CTCCACCACAATTGCATTCCTCACATCATTCACCGAGACATGAAGTCGAGCAATGTGCTT
ATCGATGAACAACTGGAAGCAAGGGTATCTGATTTCGGTATGGCGAGGCTGATGAGCGTG
GTGGATACACACCTTAGCGTGTCCACTCTTGCTGGAACGCCAGGGTATGTACCACCGGAG
TACTACCAGAGCTTCAGATGCACCACCAAGGGTGATGTTTATAGCTATGGTGTTGTGTTG
CTGGAGCTGCTCACCGGGAAACCGCCGACGGACTCGGCAGACTTTGGCGAGGACAATAAC
CTTGTGGGGTGGGTCAAGCAGCACACCAAATTGAAGATCACGGATGTCTTCGACCCTGAG
CTACTCAAGGAGGATCCATCCGTCGAGCTTGAGCTGCTGGAGCATTTGAAAATCGCCTGT
GCGTGCTTGGATGACCGGCCGTCGAGGCGGCCGACGATGCTGAAGGTGATGGCAATGTTC
AAGGAGATCCAAGCTGGGTCGACGGTCGACTCGAAGACCTCGTCGGCGGCAGCGGGCTCG
ATCGATGAGGGAGGCTATGGGGTCCTTGACATGCCCCTCAGGGAAGCCAAGGAGGAGAAG
GATTAG

Protein

1122 aa

>Os01t0718300-02 Similar to Systemin receptor SR160 precursor (EC 2.7.1.37) (Brassinosteroid LRR receptor kinase).
MDSLWAAIAALFVAAAVVVRGAAAADDAQLLEEFRQAVPNQAALKGWSGGDGACRFPGAG
CRNGRLTSLSLAGVPLNAEFRAVAATLLQLGSVEVLSLRGANVSGALSAAGGARCGSKLQ
ALDLSGNAALRGSVADVAALASACGGLKTLNLSGDAVGAAKVGGGGGPGFAGLDSLDLSN
NKITDDSDLRWMVDAGVGAVRWLDLALNRISGVPEFTNCSGLQYLDLSGNLIVGEVPGGA
LSDCRGLKVLNLSFNHLAGVFPPDIAGLTSLNALNLSNNNFSGELPGEAFAKLQQLTALS
LSFNHFNGSIPDTVASLPELQQLDLSSNTFSGTIPSSLCQDPNSKLHLLYLQNNYLTGGI
PDAVSNCTSLVSLDLSLNYINGSIPASLGDLGNLQDLILWQNELEGEIPASLSRIQGLEH
LILDYNGLTGSIPPELAKCTKLNWISLASNRLSGPIPSWLGKLSYLAILKLSNNSFSGPI
PPELGDCQSLVWLDLNSNQLNGSIPKELAKQSGKMNVGLIVGRPYVYLRNDELSSECRGK
GSLLEFTSIRPDDLSRMPSKKLCNFTRMYVGSTEYTFNKNGSMIFLDLSYNQLDSAIPGE
LGDMFYLMIMNLGHNLLSGTIPSRLAEAKKLAVLDLSYNQLEGPIPNSFSALSLSEINLS
NNQLNGTIPELGSLATFPKSQYENNTGLCGFPLPPCDHSSPRSSNDHQSHRRQASMASSI
AMGLLFSLFCIIVIIIAIGSKRRRLKNEEASTSRDIYIDSRSHSATMNSDWRQNLSGTNL
LSINLAAFEKPLQNLTLADLVEATNGFHIACQIGSGGFGDVYKAQLKDGKVVAIKKLIHV
SGQGDREFTAEMETIGKIKHRNLVPLLGYCKAGEERLLVYDYMKFGSLEDVLHDRKKIGK
KLNWEARRKIAVGAARGLAFLHHNCIPHIIHRDMKSSNVLIDEQLEARVSDFGMARLMSV
VDTHLSVSTLAGTPGYVPPEYYQSFRCTTKGDVYSYGVVLLELLTGKPPTDSADFGEDNN
LVGWVKQHTKLKITDVFDPELLKEDPSVELELLEHLKIACACLDDRPSRRPTMLKVMAMF
KEIQAGSTVDSKTSSAAAGSIDEGGYGVLDMPLREAKEEKD*

5'UTR

chr01:29931333..29931409 (- strand) : 77 bp

CDS

chr01:29927967..29931332 (- strand) : 3366 bp

3'UTR

chr01:29927628..29927966 (- strand) : 339 bp

FASTA

>Os01t0718300-02 class=Sequence position=chr01:29927628..29931409 (- strand)
ACTTTCTCTC TCTACCGCCG CTCTCGCAGC AGGCCAGGTT CTCTCTAATG GTCGTGAGGC AGTGAGCTCG CTCGTACATG
GATTCCTTGT GGGCAGCGAT AGCGGCACTG TTTGTGGCGG CGGCGGTGGT GGTGAGGGGG GCGGCGGCGG CCGACGACGC
CCAGCTGCTC GAGGAGTTCA GGCAGGCGGT GCCGAACCAG GCGGCGCTCA AGGGGTGGAG CGGCGGCGAC GGCGCGTGCA
GGTTCCCGGG GGCCGGGTGC CGGAACGGGA GGCTCACGTC GCTGTCGCTC GCCGGCGTGC CGCTCAATGC CGAGTTCCGC
GCCGTCGCGG CCACCCTGCT GCAGCTCGGC AGCGTCGAGG TGCTGAGCCT CCGCGGCGCC AACGTCAGCG GCGCGCTCTC
GGCGGCTGGC GGCGCGAGGT GCGGGAGCAA GCTGCAGGCG CTCGATTTGT CCGGGAATGC CGCGCTCCGG GGCTCCGTCG
CCGACGTGGC GGCCCTGGCC AGCGCCTGCG GCGGCCTCAA GACGCTGAAT CTCTCCGGCG ATGCGGTTGG TGCGGCGAAG
GTCGGTGGCG GTGGTGGCCC GGGCTTTGCC GGGCTGGACT CGCTTGATTT GTCCAACAAC AAGATCACCG ACGATAGCGA
CCTCCGGTGG ATGGTGGATG CCGGAGTCGG GGCAGTACGG TGGTTGGACC TTGCCCTGAA CAGGATCTCC GGTGTCCCGG
AGTTCACCAA CTGCTCCGGG CTTCAGTACC TTGACCTCTC CGGCAACCTC ATCGTCGGTG AGGTGCCCGG CGGGGCACTT
TCCGACTGCC GCGGTCTGAA AGTGCTCAAC CTCTCCTTCA ACCACCTCGC CGGCGTGTTC CCTCCGGACA TCGCCGGCCT
CACGTCGCTC AACGCCCTCA ACCTCTCCAA CAACAACTTC TCCGGCGAGC TCCCCGGCGA GGCTTTCGCA AAGCTGCAGC
AGCTTACGGC GCTCTCCCTC TCCTTCAACC ACTTCAACGG CTCCATCCCG GACACCGTAG CCTCGCTGCC GGAgctccag
cagctcgacc tcagctccaa caccttctcc ggcaccatcc cgtcgtccct ctgccaagat cccaactcca agctccatct
gctgtacctt cagaacaact acctcaccgg cggcatccca gacgccgtct ccaactgcac cagcctcGTC TCCCTCGACC
TCAGCCTCAA CTACATCAAT GGGTCCATCC CGGCATCCCT CGGCGACCTT GGCAACCTGC AGGACCTCAT CCTGTGGCAG
AACGAGCTGG AGGGCGAGAT ACCGGCGTCC CTGTCGCGCA TTCAGGGCCT CGAGCATCTC ATCCTCGACT ACAACGGGCT
CACGGGTAGC ATCCCGCCGG AGCTAGCCAA GTGCACCAAG CTGAACTGGA TTTCTTTGGC GAGCAACCGG CTGTCCGGGC
CAATCCCTTC ATGGCTTGGG AAGCTCAGCT ACTTGGCTAT CTTGAAGCTC AGCAACAATT CCTTCTCGGG GCCTATACCG
CCAGAGCTCG GTGACTGCCA GAGCTTGGTG TGGCTGGACC TGAATAGCAA TCAGCTGAAT GGATCAATAC CCAAAGAGCT
GGCCAAACAG TCTGGGAAGA TGAATGTTGG CCTCATAGTT GGACGGCCTT ACGTTTATCT TCGCAACGAC GAGCTGAGCA
GCGAGTGCCG TGGCAAGGGG AGCTTGCTGG AGTTTACCAG CATCCGACCT GATGACCTCA GTCGGATGCC GAGCAAGAAG
CTGTGCAACT TCACAAGAAT GTATGTGGGG AGCACGGAGT ACACCTTCAA CAAGAATGGT TCGATGATAT TTCTCGATTT
GTCATATAAT CAGCTGGACT CGGCGATTCC TGGCGAGCTG GGGGACATGT TCTACCTCAT GATCATGAAT CTTGGGCACA
ACCTACTGTC AGGTACCATC CCATCGCGGC TAGCAGAGGC CAAGAAGCTT GCGGTGCTTG ACCTGTCGTA TAACCAGTTG
GAAGGGCCAA TACCCAACTC TTTCTCGGCA CTTTCCTTGT CGGAGATCAA TCTGTCAAAT AATCAGCTGA ATGGAACAAT
TCCAGAGCTT GGTTCCCTTG CCACATTTCC GAAGAGCCAG TATGAGAATA ACACTGGTTT ATGTGGCTTC CCACTGCCAC
CATGTGACCA TAGTTCCCCA AGATCTTCCA ATGACCACCA ATCCCACCGG AGGCAGGCAT CGATGGCAAG CAGTATCGCT
ATGGGACTGT TATTCTCACT GTTCTGTATA ATTGTGATCA TCATAGCCAT TGGGAGCAAG CGGCGGAGGC TGAAGAATGA
GGAGGCGAGT ACCTCTCGTG ATATATATAT TGATAGCAGG TCACATTCTG CAACTATGAA TTCTGATTGG AGGCAAAATC
TCTCCGGTAC AAATCTTCTT AGCATCAACC TGGCTGCATT CGAGAAGCCA TTGCAGAATC TCACCCTGGC TGATCTTGTT
GAGGCCACAA ATGGCTTCCA CATCGCATGC CAAATTGGGT CTGGTGGGTT TGGTGATGTC TACAAGGCAC AGCTCAAGGA
TGGGAAGGTT GTTGCAATCA AGAAGCTAAT ACATGTGAGC GGGCAGGGTG ACCGGGAGTT CACTGCAGAA ATGGAGACCA
TTGGCAAGAT CAAACACCGT AACCTTGTTC CACTTCTTGG CTATTGCAAG GCTGGTGAGG AGCGGTTGTT GGTGTATGAT
TACATGAAGT TTGGCAGCTT GGAGGATGTG TTGCATGACC GCAAAAAGAT CGGTAAAAAG CTGAATTGGG AGGCAAGACG
GAAAATCGCT GTTGGAGCAG CAAGGGGTTT GGCATTCCTC CACCACAATT GCATTCCTCA CATCATTCAC CGAGACATGA
AGTCGAGCAA TGTGCTTATC GATGAACAAC TGGAAGCAAG GGTATCTGAT TTCGGTATGG CGAGGCTGAT GAGCGTGGTG
GATACACACC TTAGCGTGTC CACTCTTGCT GGAACGCCAG GGTATGTACC ACCGGAGTAC TACCAGAGCT TCAGATGCAC
CACCAAGGGT GATGTTTATA GCTATGGTGT TGTGTTGCTG GAGCTGCTCA CCGGGAAACC GCCGACGGAC TCGGCAGACT
TTGGCGAGGA CAATAACCTT GTGGGGTGGG TCAAGCAGCA CACCAAATTG AAGATCACGG ATGTCTTCGA CCCTGAGCTA
CTCAAGGAGG ATCCATCCGT CGAGCTTGAG CTGCTGGAGC ATTTGAAAAT CGCCTGTGCG TGCTTGGATG ACCGGCCGTC
GAGGCGGCCG ACGATGCTGA AGGTGATGGC AATGTTCAAG GAGATCCAAG CTGGGTCGAC GGTCGACTCG AAGACCTCGT
CGGCGGCAGC GGGCTCGATC GATGAGGGAG GCTATGGGGT CCTTGACATG CCCCTCAGGG AAGCCAAGGA GGAGAAGGAT
TAGAAACAAC AACCACCGAC ACACAGGAGA AACAGCCGGC GGTGAGTGGC CACCAACGAG GCCAGTCGGC GGCGAAATGC
CCGTAGAAAC AACAGTCATT CAGAATCAGA TGGATGCCAT TTTGAACTCT CCACACAAGC TTAGCAATCG CTTCTGATGG
TGCTACAAGA TAAGAATTTT CCAGCTGTAG GTTGATCAGT CGAAGTTGTT ATGTACCTAT AGGAGTAGAT CTTTTCTTCT
TTCTTTTTTC GCAGCTTTCT TCGTCTCCCT GTTTGTTTTT CCCGTCGCGT CGCAGTAAGA GCTGTGTATG TACATATATA
AATGTTGAAT TTTCTTTGGC GC