Os01t0718300-03

Locus

Os01g0718300

Description

Similar to Brassinosteroid-insensitive 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

D61

CGSNL Gene Name

DWARF 61

Oryzabase Gene Symbol Synonym(s)

d61*, dwf42, d61, OsBRI1, OSBRI1, BRI1, Os BRI1, Osbri1

Oryzabase Gene Name Synonym(s)

dm-type dwarf, dwarf-61, DWARF61, BRASSINOSTEROID INSENSITIVE 1, BR receptor BRASSINOSTEROID INSENSITIVE1, BRASSINOSTEROID-INSENSITIVE1, brassinosteroid insensitive 1

Transcript Evidence

AK121760 (DDBJ, Best hit)

Protein Evidence

Q0ZA03 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J033089P20 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0718300-03)

RiceXPro (AK121760)

Others

Oryzabase (2018)

KEGG (Os01t0718300-03)

Transcript

999 bp

>Os01t0718300-03 Similar to Brassinosteroid-insensitive 1.
GGGTTTGGCATTCCTCCACCACAATTGCATTCCTCACATCATTCACCGAGACATGAAGTC
GAGCAATGTGCTTATCGATGAACAACTGGAAGCAAGGGTATCTGATTTCGGTATGGCGAG
GCTGATGAGCGTGGTGGATACACACCTTAGCGTGTCCACTCTTGCTGGAACGCCAGGGTA
TGTACCACCGGAGTACTACCAGAGCTTCAGATGCACCACCAAGGGTGATGTTTATAGCTA
TGGTGTTGTGTTGCTGGAGCTGCTCACCGGGAAACCGCCGACGGACTCGGCAGACTTTGG
CGAGGACAATAACCTTGTGGGGTGGGTCAAGCAGCACACCAAATTGAAGATCACGGATGT
CTTCGACCCTGAGCTACTCAAGGAGGATCCATCCGTCGAGCTTGAGCTGCTGGAGCATTT
GAAAATCGCCTGTGCGTGCTTGGATGACCGGCCGTCGAGGCGGCCGACGATGCTGAAGGT
GATGGCAATGTTCAAGGAGATCCAAGCTGGGTCGACGGTCGACTCGAAGACCTCGTCGGC
GGCAGCGGGCTCGATCGATGAGGGAGGCTATGGGGTCCTTGACATGCCCCTCAGGGAAGC
CAAGGAGGAGAAGGATTAGAAACAACAACCACCGACACACAGGAGAAACAGCCGGCGGTG
AGTGGCCACCAACGAGGCCAGTCGGCGGCGAAATGCCCGTAGAAACAACAGTCATTCAGA
ATCAGATGGATGCCATTTTGAACTCTCCACACAAGCTTAGCAATCGCTTCTGATGGTGCT
ACAAGATAAGAATTTTCCAGCTGTAGGTTGATCAGTCGAAGTTGTTATGTACCTATAGGA
GTAGATCTTTTCTTCTTTCTTTTTTCGCAGCTTTCTTCGTCTCCCTGTTTGTTTTTCCCG
TCGCGTCGCAGTAAGAGCTGTGTATGTACATATATAAATGTTGAATTTTCTTTGGCGCAA
AATCAAAATCCGCCTAGGTTGCTCCTCGTCATTTTTTCC

CDS

618 bp

>Os01t0718300-03 Similar to Brassinosteroid-insensitive 1.
GGTTTGGCATTCCTCCACCACAATTGCATTCCTCACATCATTCACCGAGACATGAAGTCG
AGCAATGTGCTTATCGATGAACAACTGGAAGCAAGGGTATCTGATTTCGGTATGGCGAGG
CTGATGAGCGTGGTGGATACACACCTTAGCGTGTCCACTCTTGCTGGAACGCCAGGGTAT
GTACCACCGGAGTACTACCAGAGCTTCAGATGCACCACCAAGGGTGATGTTTATAGCTAT
GGTGTTGTGTTGCTGGAGCTGCTCACCGGGAAACCGCCGACGGACTCGGCAGACTTTGGC
GAGGACAATAACCTTGTGGGGTGGGTCAAGCAGCACACCAAATTGAAGATCACGGATGTC
TTCGACCCTGAGCTACTCAAGGAGGATCCATCCGTCGAGCTTGAGCTGCTGGAGCATTTG
AAAATCGCCTGTGCGTGCTTGGATGACCGGCCGTCGAGGCGGCCGACGATGCTGAAGGTG
ATGGCAATGTTCAAGGAGATCCAAGCTGGGTCGACGGTCGACTCGAAGACCTCGTCGGCG
GCAGCGGGCTCGATCGATGAGGGAGGCTATGGGGTCCTTGACATGCCCCTCAGGGAAGCC
AAGGAGGAGAAGGATTAG

Protein

206 aa

>Os01t0718300-03 Similar to Brassinosteroid-insensitive 1.
GLAFLHHNCIPHIIHRDMKSSNVLIDEQLEARVSDFGMARLMSVVDTHLSVSTLAGTPGY
VPPEYYQSFRCTTKGDVYSYGVVLLELLTGKPPTDSADFGEDNNLVGWVKQHTKLKITDV
FDPELLKEDPSVELELLEHLKIACACLDDRPSRRPTMLKVMAMFKEIQAGSTVDSKTSSA
AAGSIDEGGYGVLDMPLREAKEEKD*

5'UTR

chr01:29928585..29928585 (- strand) : 1 bp

CDS

chr01:29927967..29928584 (- strand) : 618 bp

3'UTR

chr01:29927587..29927966 (- strand) : 380 bp

FASTA

>Os01t0718300-03 class=Sequence position=chr01:29927587..29928585 (- strand)
GGGTTTGGCA TTCCTCCACC ACAATTGCAT TCCTCACATC ATTCACCGAG ACATGAAGTC GAGCAATGTG CTTATCGATG
AACAACTGGA AGCAAGGGTA TCTGATTTCG GTATGGCGAG GCTGATGAGC GTGGTGGATA CACACCTTAG CGTGTCCACT
CTTGCTGGAA CGCCAGGGTA TGTACCACCG GAGTACTACC AGAGCTTCAG ATGCACCACC AAGGGTGATG TTTATAGCTA
TGGTGTTGTG TTGCTGGAGC TGCTCACCGG GAAACCGCCG ACGGACTCGG CAGACTTTGG CGAGGACAAT AACCTTGTGG
GGTGGGTCAA GCAGCACACC AAATTGAAGA TCACGGATGT CTTCGACCCT GAGCTACTCA AGGAGGATCC ATCCGTCGAG
CTTGAGCTGC TGGAGCATTT GAAAATCGCC TGTGCGTGCT TGGATGACCG GCCGTCGAGG CGGCCGACGA TGCTGAAGGT
GATGGCAATG TTCAAGGAGA TCCAAGCTGG GTCGACGGTC GACTCGAAGA CCTCGTCGGC GGCAGCGGGC TCGATCGATG
AGGGAGGCTA TGGGGTCCTT GACATGCCCC TCAGGGAAGC CAAGGAGGAG AAGGATTAGA AACAACAACC ACCGACACAC
AGGAGAAACA GCCGGCGGTG AGTGGCCACC AACGAGGCCA GTCGGCGGCG AAATGCCCGT AGAAACAACA GTCATTCAGA
ATCAGATGGA TGCCATTTTG AACTCTCCAC ACAAGCTTAG CAATCGCTTC TGATGGTGCT ACAAGATAAG AATTTTCCAG
CTGTAGGTTG ATCAGTCGAA GTTGTTATGT ACCTATAGGA GTAGATCTTT TCTTCTTTCT TTTTTCGCAG CTTTCTTCGT
CTCCCTGTTT GTTTTTCCCG TCGCGTCGCA GTAAGAGCTG TGTATGTACA TATATAAATG TTGAATTTTC TTTGGCGCAA
AATCAAAATC CGCCTAGGTT GCTCCTCGTC ATTTTTTCC